Recombinant Cowpea severe mosaic virus RNA1 polyprotein

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag will be determined during production. To prioritize a specific tag, please inform us during order placement.
Synonyms
RNA1 polyprotein; Genome polyprotein B; P1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1147-1858
Protein Length
Full Length of Mature Protein
Species
Cowpea severe mosaic virus (strain DG) (CPSMV)
Target Protein Sequence
AAEKFFDFLEKEQHVTEGIGKVGNLKKGVWVPLPTKTNLVETPKEWHLGTEKTKEPSILS STDLRLGDKQYDPFVGGIQKYAEPMGILDDEVLRHVATDIVEEWFDCVDPQEDTFEEVDL QVAINGLEGMEYMERVPMATSEGFPHILTRKSGEKGKGRFVYGDGEIFDLIPGTSVHEAY LTLEETCADTVPALVGIECPKDEKLPLRKIYEKPKTRCFTVLPMEYNLVVRRKFLKFVVF IMKNRHRLSCQVGINPYGMEWSRLAMSLLEKGNNILCCDYSSFDGLLTKQVMHLMSEMIN ELCGGSSRLKQQRTNLLMACCSRYALCKGEVWRVECGIPSGFPLTVICNSIFNELLVRYS YIKICQQARVPATITYGFSTFVKMVTYGDDNLLSVQSAITHVFDGTKLKEFLKLNGITIT DGKDKTSPVLNFRNLEDCDFLKRGFKKESDVVWVGPEEKESLWAQLHYVTTNNLEKHEAY LVNVVNVIRELYLHDPREAAELRRKAIQNVDFLKENPKDLPTMAAIKEFYNMQRQQQFVD SNDNLDSLLNPDFLFVAPHRKMHEAEMELVPKWYLRDLGKAPINVLTGEADRICVLVNAS IPDHLLPEKVVNISWPYGPGRGGLPTHGWAQANLYNPNSAVVKKLRTLVNQNPDDRVDIC FRHDAVPVAIATIIFLVHLGKVKGRSANEYLTKIIDSAKSLKFLPKECDIIF
Uniprot No.

Target Background

Function

This thiol protease cleaves the RNA1 and RNA2 polyproteins, playing a crucial role in RNA replication. It covalently binds to the 5' terminus of both viral single-stranded RNA1 and RNA2 molecules. Furthermore, it down-regulates RNA1 polyprotein processing and enhances the trans-cleavage of RNA2 polyproteins. The protease cofactor and putative helicase appear to target replication complexes to endoplasmic reticulum (ER) membranes. Their interaction induces ER membrane rearrangement, potentially leading to the formation of small membranous vesicles serving as sites for viral RNA synthesis. This process is essential for viral genome replication.

Protein Families
Comoviridae genome polyprotein B family
Subcellular Location
[Putative helicase]: Host membrane; Single-pass membrane protein. Host cytoplasm, host perinuclear region.; [RNA-directed RNA polymerase]: Host endoplasmic reticulum.; [Protease cofactor]: Host cytoplasm, host perinuclear region.

Q&A

What is the structure and processing mechanism of CPMV RNA1 polyprotein?

CPMV RNA1 encodes a large polyprotein that undergoes proteolytic processing to generate individual functional proteins. The RNA1-encoded polyprotein is cleaved by the virus-encoded 24-kDa proteinase (24K) to produce several mature proteins with distinct functions. The major proteins derived from this polyprotein include the 32-kDa protein (32K), the 60-kDa nucleotide binding protein (60K), the 24K proteinase itself, and the 110-kDa polymerase (110K) . The processing occurs in a specific order, with the 24K proteinase mediating all the cleavage events. This proteolytic processing is essential for viral replication as it generates the individual proteins required for different stages of the viral life cycle .

What are the functions of individual proteins encoded by CPMV RNA1?

The CPMV RNA1-encoded proteins have distinct functions in viral replication:

  • 32K protein: Acts as a proteinase cofactor that associates with host membranes, particularly from the endoplasmic reticulum (ER). It plays a critical role in membrane rearrangement necessary for establishing viral replication complexes .

  • 60K protein: Contains NTP-binding motifs and also associates with membranes. This protein contributes to membrane rearrangement and is likely involved in energy-dependent processes during viral replication .

  • 24K proteinase: Functions as the viral protease responsible for processing the viral polyproteins. Recent research has shown that it also interacts with host defense proteins like lipid transfer protein 1 (LTP1) .

  • 110K protein: Contains the RNA-dependent RNA polymerase (RdRp) domain and is responsible for viral RNA synthesis. Unlike 32K and 60K, the 110K protein is predominantly found in the soluble fraction when expressed individually .

What experimental systems are used to study CPMV RNA1 polyprotein and its processed proteins?

Several experimental systems have proven effective for studying CPMV RNA1 polyprotein:

  • Transient expression in cowpea protoplasts: Using plant expression vectors like pMON999 with the enhanced cauliflower mosaic virus (CaMV) 35S promoter to express individual viral proteins .

  • Tobacco rattle virus (TRV) expression vectors: For expressing viral proteins in intact plants, particularly Nicotiana benthamiana .

  • Epitope tagging: Adding tags such as the hemagglutinin (HA) epitope to enhance detection of viral proteins that may accumulate at low levels or for which high-quality antibodies are not available .

  • Subcellular fractionation: Separating membrane-bound proteins from soluble proteins through differential centrifugation (e.g., 30,000 × g separation) .

  • Yeast two-hybrid (Y2H) screening: Identifying host proteins that interact with viral proteins, as demonstrated in the identification of LTP1 as an interactor with 24KPro .

  • Immunoprecipitation coupled to mass spectrometry (IP-MS): Another approach for identifying virus-host protein interactions .

How do CPMV RNA1-encoded proteins interact with host cell membranes?

CPMV replication occurs in close association with small membranous vesicles formed through rearrangement of intracellular membranes, primarily the endoplasmic reticulum (ER). Research has revealed:

  • The 32K and 60K proteins, when expressed individually, associate predominantly with membrane fractions (P30) while 110K and 24K remain in the soluble fraction (S30) .

  • Expression of 32K and 60K causes proliferation and rearrangement of ER membranes similar to what occurs during CPMV infection, suggesting these proteins contain the signals necessary for targeting the viral replication complex to ER membranes .

  • These membrane rearrangements are believed to result in the formation of small membranous vesicles that become the sites of viral RNA synthesis .

  • Both 32K and 60K appear to be cytotoxic when expressed alone, causing necrosis in inoculated N. benthamiana leaves. Interestingly, during normal CPMV infection, these proteins accumulate without causing necrosis, suggesting that other viral components may modulate their cytotoxic effects .

What host factors interact with CPMV proteins and how do they affect viral replication?

Recent research has identified several host proteins that interact with CPMV proteins, particularly with the 24K proteinase:

  • Lipid transfer protein 1 (LTP1): This cowpea protein specifically interacts with the active form of 24KPro but not with the enzymatically inactive mutant 24KPro(C166A) .

  • LTP1 inhibits the proteolytic activity of 24KPro both in vitro and in vivo, preventing efficient processing of viral polyproteins .

  • Overexpression of LTP1 in cowpea reduced CPMV infection, while RNA interference-mediated LTP1 silencing increased viral accumulation .

  • LTP1 normally localizes in the apoplast but relocates to intracellular compartments including chloroplasts during CPMV infection .

  • The inhibitory function of LTP1 extends beyond CPMV; heterologous expression of cowpea LTP1 in tobacco plants suppressed infection by soybean mosaic virus by inhibiting its protease activity .

Other host factors identified as interacting with CPMV 24KPro include eukaryotic translation initiation factors (eIF1A, eIF3B, eIF3L), 26S proteasome regulatory subunits, and various defense-related proteins .

What strategies can be employed to express and study recombinant viral proteins?

Researchers have developed several strategies to express and study recombinant CPMV proteins:

  • Design of expression constructs:

    • Adding start codons at the 5' end and stop codons at the 3' end of individual viral protein coding sequences

    • Incorporating epitope tags (e.g., HA tag) to enhance detection

    • Using strong promoters such as the enhanced CaMV 35S promoter

  • Expression systems:

    • Plant protoplast transient expression for initial characterization

    • Viral vector-based expression (e.g., TRV vectors) for in planta studies

    • Split-luciferase complementation assays for studying protein-protein interactions

  • Protein activity assays:

    • In vitro protease activity assays using recombinant substrates

    • Site-directed mutagenesis to create enzymatically inactive controls (e.g., 24KPro(C166A))

  • Localization studies:

    • Subcellular fractionation followed by Western blot analysis

    • Fluorescent protein fusions for live-cell imaging

How can knowledge about CPMV RNA1 polyprotein processing be applied to develop viral resistance strategies?

The identification of LTP1 as an inhibitor of viral protease activity suggests potential strategies for developing resistance against CPMV and related viruses:

  • Overexpression of protease inhibitors: Transgenic expression of LTP1 or similar protease inhibitors could provide resistance against viruses that rely on proteolytic processing .

  • Cross-protection strategies: The finding that cowpea LTP1 can inhibit proteases from different viruses (CPMV and soybean mosaic virus) suggests that targeting conserved features of viral proteases could provide broad-spectrum resistance .

  • Engineered resistance based on structure-function relationships: Understanding the molecular basis of LTP1-24KPro interaction could guide the design of synthetic inhibitors with enhanced specificity and efficacy .

  • RNA interference approaches: The observation that silencing of LTP1 increases viral accumulation suggests that boosting expression of this and similar defense genes could enhance resistance .

What techniques are effective for detecting membrane association of viral replication proteins?

Researchers have employed multiple complementary approaches to study the membrane association of CPMV replication proteins:

  • Differential centrifugation: Separation of soluble proteins (S30) from membrane-associated proteins (P30) by centrifugation at 30,000 × g provides initial evidence of membrane association .

  • Western blot analysis: Using specific antibodies or epitope tags (such as HA) to detect viral proteins in different subcellular fractions .

  • Electron microscopy: Visualization of membrane rearrangements and the formation of vesicular structures upon expression of viral proteins or during infection .

  • Immunogold labeling: Precise localization of viral proteins in relation to cellular membranes and organelles .

These approaches can be combined to provide comprehensive evidence of the membrane association of viral replication proteins and the nature of membrane rearrangements induced during infection.

How can researchers study the interaction between viral proteases and host defense proteins?

The study of interactions between viral proteases and host defense proteins, as exemplified by the 24KPro-LTP1 interaction, involves several specialized techniques:

  • Yeast two-hybrid (Y2H) screening: This approach can identify candidate interacting proteins from a cDNA library, as demonstrated in the identification of LTP1 as a 24KPro interactor .

  • Immunoprecipitation coupled to mass spectrometry (IP-MS): This technique provides an alternative, complementary approach for identifying protein-protein interactions in a more native context .

  • Split-luciferase complementation assays: This method can validate protein-protein interactions in plant cells, allowing comparison between wild-type and mutant proteins (e.g., active vs. inactive protease) .

  • In vitro protease activity assays: These assays can directly assess the impact of candidate inhibitors on protease function using purified components .

  • Transgenic or transient expression approaches: Overexpression or silencing of candidate interactors in planta, followed by viral challenge, can reveal their functional significance in defense .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.