Recombinant Coxiella burnetii ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Production and Biochemical Characteristics

Recombinant atpB is produced via heterologous expression in E. coli or mammalian cells, depending on the desired form and application. Key characteristics include:

ParameterFull-Length (His-Tagged) Partial (Mammalian)
Protein LengthFull-length (1–264 aa)Partial (specific region unspecified)
Expression HostE. coliMammalian cells
TagN-terminal His-tagNot specified
Purity>90% (SDS-PAGE)>85% (SDS-PAGE)
Storage BufferTris/PBS + 6% trehalose, pH 8.0Tris-based buffer, 50% glycerol
UniProt IDB6J2D4 B6J957
AA SequenceMYAQPKLTSAEYVQHHMSHWKLNLHNFTFTDGGFWTLNLDTLIISVVLGALFILIFYIIA...Partial sequence not provided

The full-length His-tagged version (UniProt: B6J2D4) is widely used for structural and functional studies, while the partial version (UniProt: B6J957) is tailored for specific applications requiring truncated domains. Both forms are lyophilized or stored in glycerol-containing buffers to prevent degradation.

Applications in Research and Diagnostics

Recombinant atpB is utilized in:

Diagnostic Development

Although not directly cited in peer-reviewed studies, atpB shares production strategies with other C. burnetii recombinant proteins used in ELISA-based diagnostics . For example:

  • ELISA Antigen: Potential use in detecting anti-atpB antibodies in Q fever sera, though cross-reactivity with conserved bacterial proteins (e.g., Chlamydia) remains a concern .

  • Comparative Performance: Recombinant antigens like Com1 (a phase I antigen) show high specificity in sheep, goats, and cattle , suggesting similar potential for atpB.

Research Gaps and Challenges

  1. Limited Functional Data: Most studies focus on C. burnetii effectors (e.g., CvpB, CinF) rather than metabolic enzymes like atpB .

  2. Diagnostic Specificity: Whole-cell antigens risk cross-reactivity; recombinant atpB could improve specificity but requires validation against clinical sera.

  3. Expression Challenges: Mammalian cell-expressed partial atpB may face solubility issues, necessitating optimization .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; CBU_1939; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-264
Protein Length
full length protein
Species
Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Target Names
atpB
Target Protein Sequence
MYAQPKLTSAEYVQHHMSHWKLNLHNFTFTDGGFWTLNLDTLIISVVLGALFILIFYIVA RRATASVPGKWQNAIEMAVEAVDGTVKDSFHGDRSLVAPLALTIFIWVFLMNFMDLVPVD LIPRLFQMGGVEHFKAVPTADPTLTFAMSITVFVLVIFYNFKMKGAIGLGKEVLSRPFGW YLMPINVIFRLIDEGVKPISLALRLFGNLFAGELIFILIALLPWWSQFTLGMVWTLFHLL VITVQAFIFMMLTVVYISLAAESH
Uniprot No.

Target Background

Function
This protein is a key component of the proton channel. It plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and function of C. burnetii ATP synthase subunit a?

ATP synthase subunit a (atpB) is an integral membrane protein component of the F0 sector of the ATP synthase complex in Coxiella burnetii. It plays a crucial role in proton translocation across the bacterial membrane, which drives ATP synthesis through the coupled F1 domain. This protein is encoded by the atpB gene (locus CBU_1939) and consists of 264 amino acids organized into multiple transmembrane helices that form a proton-conducting channel. The protein's function is essential for energy metabolism in C. burnetii, particularly during its obligate intracellular lifestyle within the acidic parasitophorous vacuole .

How does C. burnetii ATP synthase contribute to bacterial survival in the intracellular environment?

C. burnetii has evolved to survive within acidic lysosome-derived vacuoles in host cells, making its energy metabolism uniquely adapted to this challenging niche. Recent metabolic studies show that C. burnetii can utilize both glucose and glutamate during infection, with these substrates feeding into pathways that ultimately generate the proton motive force required for ATP synthesis. The ATP synthase complex, including the atpB subunit, appears to function efficiently under acidic conditions, allowing the pathogen to maintain energy homeostasis within the host cell environment. This adaptation is critical for C. burnetii's ability to establish a replication-permissive niche and cause persistent infection .

What expression systems are most effective for producing recombinant C. burnetii atpB?

Successful expression of membrane proteins like atpB requires specialized approaches:

Table 1: Expression Systems for C. burnetii atpB Production

Expression SystemAdvantagesConsiderations
E. coli strains specialized for membrane proteins (C41/C43)Well-established protocols, cost-effectiveMay require codon optimization for C. burnetii genes
Cell-free expression systems (IVTT)Avoids toxicity issues, rapid productionHigher cost, potentially lower yields
Insect cell systemsBetter for complex membrane proteinsMore complex setup, longer production time

For atpB specifically, E. coli-based systems with inducible promoters and fusion tags (such as His-tags) have shown success in producing the recombinant protein for analysis and antibody production. The choice of expression vector and host strain should be optimized for membrane protein expression, with special attention to induction conditions to prevent toxicity .

What purification strategies yield functionally intact C. burnetii ATP synthase subunit a?

Membrane protein purification requires specialized protocols:

  • Membrane isolation: Selective fractionation of bacterial membranes containing expressed atpB

  • Detergent solubilization: Screening of detergents (DDM, LMNG, etc.) for optimal extraction without denaturation

  • Affinity chromatography: Utilization of introduced tags (typically His-tag) for initial purification

  • Size-exclusion chromatography: Removal of aggregates and isolation of properly folded protein

  • Quality assessment: Verification of purity and functional state through electrophoresis and activity assays

The recombinant protein should be maintained in a Tris-based buffer containing 50% glycerol to preserve stability, with storage at -20°C for short-term or -80°C for extended storage. Repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week .

How can researchers verify the structural integrity of purified recombinant atpB?

Verification of proper folding is essential for functional studies:

  • Circular dichroism spectroscopy: Analysis of secondary structure content to confirm proper folding

  • Limited proteolysis: Assessment of accessible cleavage sites that indicate native conformation

  • Thermal stability assays: Measurement of protein stability under different buffer conditions

  • Functional reconstitution: Incorporation into liposomes to assess proton translocation capability

  • Binding assays: Verification of interactions with known binding partners or inhibitors

These approaches collectively provide evidence that the recombinant protein maintains its native structural features necessary for biological function.

What methods are suitable for investigating the membrane topology of C. burnetii atpB?

Several complementary approaches can determine topology:

  • Cysteine scanning mutagenesis: Introduction of cysteine residues at various positions followed by accessibility studies with membrane-impermeable reagents

  • Protease protection assays: Digestion of accessible regions in intact membrane vesicles versus detergent-solubilized protein

  • Epitope insertion: Introduction of epitope tags at predicted loops followed by antibody accessibility studies

  • Cryo-electron microscopy: Structural determination of the assembled ATP synthase complex, potentially revealing atpB orientation

  • Computational prediction: Use of topology prediction algorithms validated with experimental data

Integration of multiple methods provides the most reliable topological model of membrane insertion and orientation.

How can researchers assess the proton translocation function of recombinant atpB?

Functional analysis requires specialized biophysical techniques:

  • Liposome reconstitution with pH-sensitive fluorophores: Direct measurement of proton movement across membranes containing atpB

  • Patch-clamp electrophysiology: Electrical recording of proton conductance through atpB channels

  • ATP synthesis assays: Measurement of ATP production in reconstituted systems with imposed proton gradients

  • Site-directed mutagenesis: Systematic alteration of putative proton-conducting residues and assessment of functional consequences

  • Acidification resistance assays: Testing protein function across pH ranges relevant to the C. burnetii intracellular niche

These methods can establish the mechanistic details of how atpB contributes to ATP synthesis under conditions that mimic the intracellular environment of this pathogen.

How does ATP synthase activity contribute to C. burnetii's adaptation to different carbon sources?

Recent metabolic studies have revealed important insights about C. burnetii's energy metabolism:

Table 2: Carbon Utilization in C. burnetii

Carbon SourceMetabolic PathwayATP Synthase Contribution
GlucoseGlycolysisUtilizes proton gradient generated by NADH oxidation
GlutamateTCA cycleDirectly couples to electron transport chain activity

Intracellular C. burnetii appears to utilize both glucose and glutamate during infection, though the metabolic pathway profiles differ between axenically cultivated bacteria and those growing within host cells. The ATP synthase complex plays a crucial role in harvesting energy from these carbon sources, with atpB specifically facilitating the proton translocation that drives ATP synthesis. Disruption of glucose transport affects bacterial metabolism but doesn't completely abolish growth, suggesting metabolic flexibility where amino acids may serve as alternative carbon sources .

Could C. burnetii ATP synthase serve as a target for antimicrobial development?

The essential nature of ATP synthesis for bacterial survival makes the ATP synthase complex a potential therapeutic target. Research considerations include:

  • Essentiality assessment: Determining whether atpB is absolutely required for C. burnetii survival

  • Selective inhibition: Identifying differences between bacterial and human ATP synthases that could be exploited

  • Inhibitor screening: Development of high-throughput assays to identify compounds that specifically inhibit C. burnetii ATP synthase

  • Delivery challenges: Designing inhibitors that can penetrate host cells and the C. burnetii-containing vacuole

  • Resistance mechanisms: Understanding potential compensatory pathways that might emerge upon ATP synthase inhibition

While not specifically explored in current literature, the ATP synthase represents a promising target given its central role in bacterial bioenergetics.

How can researchers investigate the interaction between atpB and other ATP synthase components?

Advanced structural biology and protein interaction studies include:

  • Co-purification of ATP synthase complexes: Isolation of intact complexes followed by component identification through mass spectrometry

  • Cross-linking mass spectrometry: Chemical cross-linking of interacting components followed by identification of contact residues

  • Bacterial two-hybrid systems: Genetic screening for protein-protein interactions adapted for membrane proteins

  • Single-particle cryo-electron microscopy: Direct visualization of the assembled ATP synthase complex structure

  • Molecular dynamics simulations: Computational prediction of stable interaction interfaces between components

These complementary approaches can provide a detailed picture of how atpB interacts with other subunits to form a functional ATP synthase complex.

What adaptations in C. burnetii ATP synthase enable function in acidic vacuoles?

C. burnetii's unique adaptation to acidic intracellular compartments likely involves specialized features of its ATP synthase:

  • Comparative sequence analysis: Identification of amino acid differences between C. burnetii atpB and homologs from neutralophilic bacteria

  • pH-dependent activity profiling: Characterization of enzyme activity across pH ranges from 4.0-7.5

  • Mutation studies: Testing the functional impact of replacing C. burnetii-specific residues with consensus residues from other bacteria

  • Proton binding kinetics: Measuring how acidic conditions affect proton association/dissociation from key residues

  • Structural stability analysis: Assessing protein stability under acidic conditions compared to neutral pH

These studies could reveal unique adaptations that allow C. burnetii to maintain ATP synthesis within the acidified parasitophorous vacuole, contributing to our understanding of how this pathogen survives in this challenging niche.

What are common difficulties in working with recombinant C. burnetii atpB, and how can they be addressed?

Table 3: Common Challenges and Solutions for C. burnetii atpB Research

ChallengeCausesMethodological Solutions
Poor expressionToxicity to host, codon bias, membrane proteinUse tight expression control, codon optimization, membrane protein-specific strains
Inclusion body formationImproper folding, overexpressionLower induction temperature, use fusion partners, optimize inducer concentration
Loss of function during purificationDetergent denaturationScreen detergent panel, use milder extraction conditions, validate with functional assays
Limited stabilityIntrinsic membrane protein instabilityAdd stabilizing agents (glycerol, lipids), maintain at 4°C, avoid freeze-thaw cycles
Aggregation during storageDetergent micelle disruptionStore with 50% glycerol, maintain detergent above CMC, consider newer stabilization technologies

As recommended in commercial protocols, maintaining the protein in a Tris-based buffer with 50% glycerol and storing working aliquots at 4°C for no more than one week can help preserve functionality for experimental use .

How can researchers address solubility issues with recombinant C. burnetii atpB?

Membrane protein solubility can be enhanced through several strategies:

  • Detergent screening: Systematic testing of different detergents (mild non-ionic, zwitterionic, etc.) for optimal solubilization

  • Alternative solubilization platforms: Utilization of styrene-maleic acid copolymer lipid particles (SMALPs), nanodiscs, or amphipols

  • Buffer optimization: Systematic variation of pH, ionic strength, and additives to enhance solubility

  • Fusion partners: Addition of solubility-enhancing tags such as MBP or SUMO

  • Directed evolution approaches: Selection for more soluble variants while maintaining function

Each of these approaches should be validated with functional assays to ensure that improved solubility does not come at the cost of native structure or activity.

How conserved is atpB across different C. burnetii strains and isolates?

Understanding strain variation can provide insights into essential functional domains:

  • Genomic comparison: Analysis of atpB sequences across reference strains (such as Nine Mile RSA493) and clinical isolates

  • Polymorphism identification: Mapping of strain-specific variations onto structural models

  • Selection pressure analysis: Calculation of dN/dS ratios to identify regions under purifying or diversifying selection

  • Structure-function correlation: Prediction of how observed variations might affect protein function

  • Experimental validation: Functional comparison of atpB variants from different strains

What can comparative analysis of C. burnetii atpB with other bacterial ATP synthases reveal?

Evolutionary insights from comparative studies include:

  • Phylogenetic analysis: Placement of C. burnetii atpB in the context of other alpha-proteobacterial homologs

  • Identification of unique features: Comparison with ATP synthases from bacteria inhabiting different niches

  • Adaptation signatures: Detection of amino acid changes associated with adaptation to intracellular lifestyle

  • Functional domain conservation: Mapping of universally conserved regions essential for ATP synthase function

  • Horizontal gene transfer assessment: Evaluation of whether atpB shows evidence of exchange with other species

Such comparative approaches can reveal how C. burnetii has adapted its ATP synthase for function in its unique ecological niche as an acidophilic intracellular pathogen.

What statistical approaches are appropriate for analyzing functional assays of C. burnetii ATP synthase?

  • Replicate design: Minimum of three biological replicates and three technical replicates per condition

  • Normalization methods: Standardization to protein concentration, unit membrane area, or known reference activities

  • Statistical testing: Application of appropriate parametric or non-parametric tests based on data distribution

  • Multiple comparison correction: Use of Bonferroni or false discovery rate adjustments when comparing multiple conditions

  • Effect size reporting: Inclusion of confidence intervals and magnitudes of differences, not just p-values

Which bioinformatic tools are most valuable for predicting C. burnetii atpB structure and interactions?

Computational resources enhance experimental approaches:

Table 4: Bioinformatic Tools for C. burnetii atpB Analysis

Analysis TypeRecommended ToolsApplication
Transmembrane topologyTMHMM, TOPCONS, PhobiusPrediction of membrane-spanning regions
Homology modelingSwiss-Model, I-TASSER, AlphaFoldGeneration of 3D structural models
Molecular dynamicsGROMACS, NAMDSimulation of protein behavior in membranes
Protein-protein interactionPSICQUIC, STRINGPrediction of interaction partners
Conservation analysisConSurf, Rate4SiteIdentification of functionally important residues

Integration of these computational approaches with experimental data provides the most comprehensive understanding of C. burnetii atpB structure, function, and interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.