Recombinant Coxiella burnetii DNA translocase FtsK (ftsK)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Coxiella burnetii DNA Translocase FtsK (ftsK)

Recombinant Coxiella burnetii DNA translocase FtsK (ftsK) is a genetically engineered protein derived from the obligate intracellular bacterium Coxiella burnetii, the causative agent of Q fever. This recombinant version is expressed in Escherichia coli and includes an N-terminal His tag for purification and functional studies . FtsK is a critical component of bacterial cell division machinery, coordinating chromosome segregation and activating site-specific recombination to resolve chromosome dimers .

DNA Translocation

FtsK translocates double-stranded DNA (dsDNA) at rates exceeding 5,000 base pairs per second, driven by ATP hydrolysis . The hexameric α/β subdomains form a central channel for DNA passage, while the γ subdomain regulates directionality .

Activation of XerCD Recombinases

FtsK’s γ subdomain interacts with XerD to activate site-specific recombination at the dif site, resolving chromosome dimers. This ensures proper segregation of genetic material during cell division .

Role in Cell Division

In Coxiella burnetii, FtsK interacts with FtsZ and FtsA to stabilize the divisome and recruit peptidoglycan synthesis machinery. Mutations in FtsK or FtsZ lead to filamentation and defective cell division .

Coxiella burnetii Studies

  • ftsZ Mutant Phenotype: A C. burnetii ftsZ mutant exhibited reduced growth, filamentation, and impaired FtsZ-FtsA interactions, highlighting FtsK’s role in divisome assembly .

  • Cross-Species Functionality: C. burnetii XerL and its dif site can substitute for the native system in Legionella pneumophila, resolving chromosome dimers and supporting plasmid stability .

Mechanistic Insights

  • Translocation Models: Proposed mechanisms include a rotary inchworm (conformational shifts between α/β subunits) and revolution (DNA passage through a hexameric channel) .

  • Directional Control: FtsK’s γ subdomain binds KOPS motifs (5'-GGGNAGGG-3') to enforce translocation toward the dif site .

Applications and Significance

Recombinant FtsK is used in:

  • Structural Studies: X-ray crystallography and single-molecule assays to map DNA-FtsK interactions .

  • Functional Assays: Testing ATP-dependent DNA translocation and XerCD activation in vitro .

  • Pathogen Research: Elucidating C. burnetii’s strategies for chromosome segregation and plasmid maintenance .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, if you have specific requirements for the format, please indicate them when placing your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to gather the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To ensure long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
ftsK; spoIIIE; CBU_1191; DNA translocase FtsK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-778
Protein Length
full length protein
Species
Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Target Names
ftsK
Target Protein Sequence
MGRRKGKKSAKETGVLLRRHLRYRLREGCFILALAFSAFLFIALLSYHRSDPGWSHSIVV KHVANLTGEAGAWLSDFTLYMVGYLAYIFPLMVAFAAWVFFRNRHEEQDIPTKWPLLILR AVGFLLILLAGSALAAIHLGTLDANLPYNGGGIIGVVMAKSLFPIFNTAGTSLILIAFLL IGITLFTGLSWFQFLELLGKNAIKFTKFCAIRLGAISWKDLFLSLLPSQDKREAVTVPKI KRVEPDLVPDALDMISTPKIAERPKLEIIDHEFKTPRFKGSAILPELSLLDKPSQDHTLS YSEEELQQKSREVELRLADFGIQAKVVAVHPGPVVTRFELQLAAGTKASRVTNLAKDLAR SLSVISVRIVEVIPGKSVIGLELPNKNREVVTIYEVLATKQYQNARSSLTLALGKDIGGH PVIVDLAKMPHLLVAGTTGSGKSVSLNAMLLSLLYKSTPQQLRLILIDPKMLELSVYEGI PHLLTPVVTDMKDAAAALRWCVVEMERRYRLMASLGVRNILGYNAKVKEAIEAGAPLLDP LQAAAEGKPPELQELPQLVVIADEFADMMVVVGKKVETLIVRLAQKARAAGIHLIFATQR PSVDVITGLIKANIPTRVAFQVSSKIDSRTILDQQGAEQLLGHGDLLYLAPGSGVPVRVH GPYVKDEEVHRVAEYLRESSEPNYVEGILDEMGAQDLSGFVEAALGGGSEEGGESDPLYD EAVEAVIRSRRVSVSSIQRRFKIGYNRAARIVEAMEAAGVVSPMENNGAREVLAPSKE
Uniprot No.

Target Background

Function
FtsK is an essential cell division protein that plays a crucial role in coordinating cell division and chromosome segregation. Its N-terminus is involved in the assembly of the cell-division machinery. The C-terminus functions as a DNA motor, driving dsDNA translocation in an ATP-dependent manner towards the dif recombination site, located within the replication terminus region. This translocation process terminates specifically at Xer-dif sites, where FtsK interacts with the Xer recombinase, enabling the activation of chromosome unlinking through recombination. FtsK orienting polar sequences (KOPS) guide the direction of DNA translocation. FtsK can remove proteins from DNA during translocation, but translocation stops specifically at the XerCD-dif site, preventing the removal of XerC and XerD from dif.
Database Links
Protein Families
FtsK/SpoIIIE/SftA family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Coxiella burnetii DNA translocase FtsK and what are its key functions?

Coxiella burnetii DNA translocase FtsK is a multifunctional protein that plays critical roles in bacterial chromosome segregation and cell division processes. Similar to FtsK homologs in other bacteria, C. burnetii FtsK is involved in:

  • Coordinating chromosome segregation with cell division

  • Resolving chromosome dimers through interaction with the XerCD-dif recombination system

  • Translocating DNA during the final stages of chromosome segregation

  • Forming part of the divisional septum machinery

The protein possesses ATP-dependent DNA motor activity that enables it to move DNA through the closing septum during cell division . The C-terminal domain of FtsK (FtsKC) contains the motor activity and is responsible for activating XerCD-mediated recombination at the dif site, which is essential for resolving chromosome dimers formed during homologous recombination . In other bacterial systems like E. coli, FtsK has been shown to have a dual role - both in activating XerCD recombination and in positioning the dif regions to allow productive synapse between dif sites .

What is the structural organization of C. burnetii FtsK protein?

C. burnetii FtsK is structurally organized into several functional domains, similar to FtsK proteins from other bacterial species:

  • N-terminal domain (FtsKN): Membrane-anchored domain involved in cell division

  • Linker region: Connects the N-terminal and C-terminal domains

  • C-terminal domain (FtsKC): Contains the motor function and is further divided into:

    • α and β subdomains: Form the DNA translocation motor

    • γ subdomain: Responsible for DNA sequence recognition and protein-protein interactions

The full-length C. burnetii FtsK protein consists of 778 amino acids (aa 1-778) as indicated in the recombinant protein specifications . The protein contains conserved motifs for ATP binding and hydrolysis within the motor domain, which powers DNA translocation .

In functional studies of FtsK homologs, the C-terminal domain (particularly a truncated form known as FtsK50C) forms a hexameric complex that tracks along DNA in an ATP-dependent manner to facilitate DNA translocation and activate recombination at the dif site .

How is recombinant C. burnetii FtsK typically expressed and purified?

The recombinant expression and purification of C. burnetii FtsK typically follows these methodological approaches:

Expression System:

  • E. coli is the preferred heterologous expression system

  • The full-length protein (aa 1-778) or functional domains can be expressed with affinity tags (commonly His-tag) at the N-terminus

Expression Method:

  • Clone the ftsK gene from C. burnetii genomic DNA into an appropriate expression vector

  • Transform the recombinant plasmid into E. coli expression strain

  • Induce protein expression (typically with IPTG)

  • Harvest cells and lyse to release the recombinant protein

Purification Protocol:

  • Affinity chromatography using Ni-NTA or cobalt-agarose for His-tagged proteins

  • Further purification may include ion-exchange chromatography and size-exclusion chromatography

  • Final preparation is often in Tris/PBS-based buffer with 6% trehalose at pH 8.0

Storage Considerations:

  • Store lyophilized powder at -20°C/-80°C

  • Upon reconstitution, protein can be stored at 4°C for up to one week

  • For long-term storage, aliquot with 5-50% glycerol and store at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles

What experimental systems are available to study C. burnetii FtsK function?

Several experimental systems can be employed to study C. burnetii FtsK function:

In vitro Systems:

  • DNA translocation assays: Measuring ATP-dependent DNA movement by purified FtsK

  • XerCD-dif recombination assays: Assessing FtsK-mediated activation of recombination

  • DNA binding and cleavage assays: Using specific substrates like BSN (bottom-strand nick) DNA to study FtsK-stimulated XerD cleavage

  • Protein-protein interaction assays: Co-immunoprecipitation or pull-down assays to identify interaction partners

Cellular Systems:

  • Heterologous expression in surrogate hosts: E. coli or other tractable bacterial systems

  • Genetic analysis in C. burnetii: Transposon mutagenesis of ftsK to generate mutants

  • Cell culture infection models: Using Vero cells or other cell lines to study C. burnetii during infection

Microscopy Approaches:

  • Fluorescence microscopy: Tracking FtsK-fluorescent protein fusions (e.g., FtsK-RFP) to monitor localization and dynamics

  • Time-lapse imaging: Following FtsK movement relative to nucleoid segregation and cell division

  • Z-stacking and 3D image reconstruction: Visualizing FtsK positioning within the bacterial cell

How does C. burnetii FtsK interact with the XerCD-dif recombination system?

The interaction between C. burnetii FtsK and the XerCD-dif recombination system involves specific protein-protein contacts and DNA-dependent activities that are critical for chromosome dimer resolution:

Molecular Interactions:

  • The γ subdomain of FtsK directly interacts with the C-terminus of XerD, as demonstrated in pull-down assays with homologous systems

  • This interaction is sufficient to stimulate XerD-mediated cleavage of specific DNA substrates in the absence of ATP hydrolysis

  • Full activation of complete XerCD-dif recombination requires ATP hydrolysis by the motor domain of FtsK and DNA extensions adjacent to the XerD binding site

Mechanistic Pathway:

  • FtsK translocates along DNA toward the dif site in the terminus region

  • Upon reaching dif, FtsK interacts with XerD through its γ subdomain

  • This interaction activates XerD to initiate the first strand exchange, forming a Holliday junction intermediate

  • XerC then resolves the Holliday junction to complete recombination

Experimental Evidence from Related Systems:
Studies with BSN (bottom-strand nick) DNA suicide substrates have revealed that:

  • FtsK stimulates XerD-mediated cleavage only in synaptic complexes containing two BSN DNA fragments

  • This stimulation can lead to intermolecular recombination between BSN and intact linear dif duplex without requiring ATP

  • Mutational impairment of the XerD-FtsK interaction reduces BSN cleavage in vitro and causes deficiency in chromosome dimer resolution in vivo

This FtsK-XerCD interaction mechanism is likely conserved in C. burnetii, although species-specific variations may exist in the recognition sequences and interaction details.

What methods can be used to assess the ATPase activity of recombinant C. burnetii FtsK?

Several methodological approaches can be employed to assess the ATPase activity of recombinant C. burnetii FtsK:

Colorimetric Phosphate Detection:

  • Malachite Green Assay:

    • Detects inorganic phosphate released during ATP hydrolysis

    • Provides quantitative measurement of ATPase activity

    • Can be adapted for high-throughput screening of inhibitors or activators

Enzyme-Coupled Assays:

  • Pyruvate Kinase/Lactate Dehydrogenase Coupled Assay:

    • ADP formed by FtsK is recycled to ATP by pyruvate kinase

    • Concomitant oxidation of NADH to NAD+ by lactate dehydrogenase is monitored spectrophotometrically

    • Allows real-time, continuous measurement of ATPase activity

Radiometric Assays:

  • [γ-32P]ATP Hydrolysis Assay:

    • Measures conversion of radiolabeled ATP to ADP and inorganic phosphate

    • Provides high sensitivity for detecting low levels of activity

    • Requires radioactive materials handling capabilities

DNA-Dependent ATPase Activity Assessment:

  • FtsK ATPase activity is typically stimulated by DNA

  • Include different DNA substrates (linear, circular, specific sequences) to assess DNA-dependence

  • Compare activity rates with and without DNA to determine the extent of stimulation

Experimental Design Considerations:

  • Use purified recombinant FtsK protein (full-length or motor domain)

  • Include appropriate controls (no enzyme, no ATP, denatured enzyme)

  • Test pH and salt concentration dependencies to optimize conditions

  • Assess the effects of divalent cations (typically Mg2+ is required)

  • Include DNA substrates of different topologies to evaluate specificity

The motor domains (α and β) of FtsK are responsible for ATP hydrolysis, while the γ domain is involved in DNA sequence recognition . Both activities are important for the proper function of FtsK in chromosome segregation and dimer resolution.

How can mutagenesis be used to study specific domains of C. burnetii FtsK?

Mutagenesis provides powerful approaches to dissect domain functions in C. burnetii FtsK:

Site-Directed Mutagenesis:

  • Catalytic Site Mutations:

    • Target conserved Walker A and B motifs in the ATPase domain

    • Mutations like K->A in Walker A abolish ATP binding

    • Mutations in Walker B affect ATP hydrolysis while maintaining binding

    • These mutations can separate translocation from other functions

  • Interface Mutations:

    • Target residues involved in protein oligomerization (hexamer formation)

    • Disrupt protein-protein interactions with XerD or other partners

    • Identify key residues in the γ domain that recognize specific DNA sequences

Domain Deletion/Truncation Approaches:
Research in Deinococcus radiodurans FtsK has employed strategic domain deletions that could be adapted for C. burnetii FtsK :

Mutant TypeDescriptionConstruction MethodFunctional Impact
ΔftsKComplete deletion of ftsK geneReplace coding sequence with antibiotic resistance markerAssess essentiality and global functions
ΔMCDDeletion of motor and C-terminal domainsDelete C-terminal portion while retaining N-terminal domainSeparate membrane anchoring from motor functions
ΔγDDeletion of γ domain onlyPrecise deletion of γ domainDetermine role in DNA sequence recognition
FtsK-γRFPC-terminal RFP fusionReplace γ domain with RFPMonitor localization while disrupting γ function

Complementation Studies:

  • Express wild-type or mutant FtsK variants in ΔftsK background

  • Assess rescue of phenotypes related to cell division and chromosome segregation

  • Use inducible promoters to control expression levels

Imaging-Based Analysis:
The impact of mutations can be assessed using microscopy approaches :

  • Monitor nucleoid morphology using DNA stains (DAPI, Syto-green)

  • Track membrane dynamics with lipid stains (Nile red)

  • Visualize protein localization using fluorescent protein fusions

  • Perform time-lapse imaging to observe dynamic processes

When designing mutagenesis experiments, researchers should consider the conserved nature of specific domains and motifs by comparing C. burnetii FtsK with well-characterized FtsK proteins from model organisms like E. coli or D. radiodurans .

What advanced imaging techniques can be applied to study C. burnetii FtsK dynamics?

Advanced imaging techniques provide powerful tools for investigating C. burnetii FtsK dynamics in living cells:

Fluorescent Protein Fusion Approaches:

  • FtsK-RFP/GFP Fusion Proteins:

    • Enable real-time tracking of FtsK localization and movement

    • Similar approaches in D. radiodurans revealed that FtsK forms multiple foci on both nucleoid and membrane with maximum density at the septum

    • Construction involves creating translational fusions of FtsK domains with fluorescent proteins

  • Multi-Color Imaging:

    • Combine FtsK-RFP with other divisome components tagged with different fluorescent proteins

    • Simultaneously track multiple proteins to understand temporal relationships

    • Example: FtsZ-GFP combined with FtsK-RFP revealed coordination between these proteins during division

Advanced Fluorescence Microscopy Methods:

  • Time-Lapse Microscopy:

    • Monitor FtsK dynamics through cell cycle progression

    • Capture changes in localization pattern during chromosome segregation

    • Study shift of FtsK foci from old to new septum during division

  • Z-Stacking and 3D Reconstruction:

    • Collect images at different focal planes

    • Create 3D reconstructions to visualize spatial distribution

    • Particularly useful for understanding FtsK positioning relative to nucleoid and membrane

  • Super-Resolution Microscopy:

    • Techniques like PALM, STORM, or STED bypass diffraction limit

    • Achieve resolution down to 20-30 nm for precise localization

    • Resolve individual FtsK hexameric complexes at the division site

Quantitative Imaging Analysis:

  • Line Scan Analysis (LSA):

    • Measure fluorescence intensity across developing septa

    • Compare relative intensities of nucleoid (DNA) and FtsK signals

    • Identify patterns of FtsK accumulation relative to chromosome positioning

  • Foci Tracking and Quantification:

    • Count and track individual FtsK foci over time

    • Analyze dynamics in different cell cycle stages

    • Quantify changes under stress conditions (e.g., radiation exposure)

Sample Preparation Considerations:

  • For visualization of membranes: Nile red staining (1 mg/ml)

  • For nucleoid visualization: DAPI (0.2 mg/ml) or Syto-green9 (150 nM)

  • For live-cell imaging: Mount cells on agarose pads with air holes for oxygenation

These advanced imaging approaches have revealed that FtsK forms multiple foci on both the nucleoid and cell membrane, with highest concentration at the developing septum, and dynamically relocates from old to new division sites during the cell cycle .

What are the challenges in expressing and purifying functional recombinant C. burnetii FtsK?

Expressing and purifying functional recombinant C. burnetii FtsK presents several technical challenges that researchers must address:

Expression Challenges:

  • Membrane Association:

    • The N-terminal domain of FtsK is membrane-associated, making full-length protein expression difficult

    • Solutions include:

      • Expression of soluble domains only (e.g., C-terminal motor domain)

      • Use of detergents or membrane-mimicking environments

      • Fusion with solubility-enhancing tags (MBP, SUMO, etc.)

  • Protein Toxicity:

    • Overexpression of DNA translocases can be toxic to host cells

    • Strategies include:

      • Tight regulation of expression using inducible systems

      • Use of specialized E. coli strains designed for toxic protein expression

      • Lower induction temperatures (16-20°C)

  • Codon Bias:

    • C. burnetii has different codon usage than E. coli

    • Options include:

      • Codon optimization of the ftsK sequence for E. coli expression

      • Use of E. coli strains supplying rare tRNAs

Purification Challenges:

  • Protein Solubility:

    • FtsK proteins often have solubility issues when overexpressed

    • Approaches include:

      • Addition of solubilizing agents (glycerol, trehalose)

      • Optimization of buffer conditions (pH, salt concentration)

      • Stepwise refolding protocols if needed

  • Maintaining Activity:

    • Preserving the ATP-dependent motor activity is challenging

    • Recommendations:

      • Include ATP or non-hydrolyzable analogs during purification

      • Avoid harsh elution conditions that may denature the protein

      • Test activity after each purification step

  • Oligomeric State:

    • Active FtsK typically functions as a hexamer

    • Considerations:

      • Protein concentration affects oligomerization

      • Buffer conditions influence hexamer formation

      • Characterize oligomeric state by size-exclusion chromatography

Storage and Stability:

Commercial recombinant C. burnetii FtsK is typically stored as lyophilized powder . For working preparations:

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add 5-50% glycerol for long-term storage

  • Store at -20°C/-80°C in small aliquots

  • Avoid repeated freeze-thaw cycles

  • Working aliquots may be stored at 4°C for up to one week

Quality Control Assessments:

  • Purity Analysis:

    • SDS-PAGE (>90% purity is typically desired)

    • Western blot confirmation using anti-His antibodies

  • Activity Testing:

    • ATP hydrolysis assays

    • DNA binding assays

    • Hexamer formation verification

By addressing these challenges systematically, researchers can obtain functional recombinant C. burnetii FtsK suitable for biochemical and structural studies.

How can protein-protein interaction studies be designed to identify FtsK binding partners?

Designing protein-protein interaction studies to identify C. burnetii FtsK binding partners requires systematic approaches:

Affinity-Based Methods:

  • Pull-Down Assays:

    • Immobilize His-tagged FtsK on cobalt-agarose or Ni-NTA resin

    • Incubate with C. burnetii lysate or recombinant candidate partners

    • Wash and elute bound proteins for identification

    • This approach has successfully demonstrated XerC-XerD and XerD-FtsK interactions in related systems

  • Co-Immunoprecipitation (Co-IP):

    • Generate antibodies against C. burnetii FtsK or use anti-tag antibodies

    • Precipitate FtsK complexes from bacterial lysates

    • Identify co-precipitated proteins by mass spectrometry

    • Can be performed in vivo to capture physiologically relevant interactions

Yeast Two-Hybrid (Y2H) Screening:

  • Library Screening:

    • Create a C. burnetii genomic DNA library fused to activation domain

    • Use FtsK domains as bait (fused to DNA-binding domain)

    • Screen for positive interactions through reporter gene activation

    • Verify interactions with secondary assays

  • Domain-Specific Y2H:

    • Test specific FtsK domains (N-terminal, linker, motor domains, γ domain)

    • Identify domain-specific interaction partners

    • Narrow down interaction regions through truncation analysis

Bacterial Two-Hybrid System:

  • BACTH System Application:

    • Similar studies in D. radiodurans used plasmids like pUT18 for bacterial two-hybrid assays

    • Split adenylate cyclase fragments fused to potential interacting proteins

    • Interaction reconstitutes cyclase activity, activating reporter genes

    • Particularly relevant for prokaryotic protein interactions

Crosslinking and Mass Spectrometry:

  • In Vivo Crosslinking:

    • Treat living bacteria with membrane-permeable crosslinkers

    • Isolate FtsK complexes via immunoprecipitation

    • Identify crosslinked partners by mass spectrometry

    • Provides snapshot of interactions in the cellular context

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Compare hydrogen-deuterium exchange rates of FtsK alone versus in complex

    • Map interaction interfaces with high resolution

    • Identify conformational changes upon binding

Fluorescence-Based Methods:

  • Fluorescence Resonance Energy Transfer (FRET):

    • Create fluorescent protein fusions (e.g., FtsK-CFP and candidate partner-YFP)

    • Monitor FRET signal indicating protein proximity (<10 nm)

    • Can be performed in living cells to track dynamic interactions

  • Bimolecular Fluorescence Complementation (BiFC):

    • Split fluorescent protein with segments fused to potential interacting proteins

    • Interaction brings fragments together, reconstituting fluorescence

    • Allows visualization of interaction locations within cells

Predicted Interaction Partners to Investigate:

Based on the search results and knowledge of FtsK function in other bacteria, key interaction candidates include:

  • XerC and XerD recombinases (chromosome dimer resolution)

  • FtsZ (coordination of chromosome segregation with cell division)

  • Other divisome components (FtsA, FtsQ, etc.)

  • DNA repair proteins (especially in stress response contexts)

What is the role of C. burnetii FtsK in chromosome segregation during intracellular growth?

The role of C. burnetii FtsK in chromosome segregation during intracellular growth involves several coordinated processes that ensure proper genome partitioning:

Intracellular Growth Context:

C. burnetii is an obligate intracellular pathogen that replicates within acidified parasitophorous vacuoles in host cells . This unique niche presents specific challenges for chromosome segregation:

  • Confined space within the vacuole

  • Need to coordinate replication with the parasitophorous vacuole expansion

  • Exposure to host-derived stressors (oxidative species, antimicrobial peptides)

FtsK Functions During Chromosome Segregation:

  • DNA Translocation:

    • FtsK forms hexameric motors that translocate DNA through the closing septum

    • Directional movement is guided by DNA sequence motifs (KOPS/SRS) that orient toward the terminus region

    • ATP-powered translocation ensures chromosomes clear the septum before cell division completes

  • Chromosome Dimer Resolution:

    • Homologous recombination during DNA repair can generate chromosome dimers

    • FtsK activates XerCD-mediated recombination at dif sites to resolve dimers

    • Failure in this process would result in DNA breaks during cell division

  • Coordination with Cell Division:

    • Studies in D. radiodurans show FtsK forms multiple foci on both nucleoid and membrane

    • FtsK coordinates its movement with nucleoid separation

    • Positioning shifts from old to new septum during cell cycle progression

Experimental Observations from Related Systems:

Research in D. radiodurans revealed that FtsK deletion causes severe defects in nucleoid morphology and cell division :

PhenotypeWild-typeΔftsK Mutant
Cell morphologyRegular tetrads/diadsIrregular, enlarged cells
Nucleoid organizationCompact, well-definedDiffuse, disorganized
Septum formationComplete, symmetricIncomplete, asymmetric
Growth rateNormalSignificantly reduced
Radiation resistanceHighCompromised

Methodological Approaches to Study C. burnetii FtsK During Intracellular Growth:

  • Genetic Manipulation:

    • Generate conditional ftsK mutants in C. burnetii using transposon mutagenesis

    • Develop regulated expression systems to modulate FtsK levels

    • Create domain-specific deletions to assess function

  • Advanced Microscopy:

    • Fluorescent protein fusions to track FtsK localization during intracellular growth

    • Live-cell imaging of infected host cells to observe dynamics

    • Multi-color imaging to simultaneously track FtsK, DNA, and cell division markers

  • Host Cell Infection Models:

    • Use Vero cells as established model systems for C. burnetii growth

    • Compare wild-type and FtsK-deficient strains for intracellular replication efficiency

    • Assess impact of FtsK dysfunction on bacterial morphology during infection

These approaches would provide valuable insights into how C. burnetii coordinates chromosome segregation within the unique constraints of its intracellular lifestyle, potentially revealing adaptations specific to this pathogen compared to free-living bacteria.

What protocols are recommended for expressing and purifying recombinant C. burnetii FtsK?

The following detailed protocol is recommended for expressing and purifying recombinant C. burnetii FtsK:

Materials Required:

  • C. burnetii ftsK gene sequence (GenBank accession or genomic DNA)

  • Expression vector with appropriate promoter and affinity tag (e.g., pET with His-tag)

  • E. coli expression strain (BL21(DE3) or derivatives)

  • IPTG for induction

  • Lysis buffer, wash buffer, and elution buffer

  • Chromatography columns and equipment

Expression Protocol:

  • Gene Cloning:

    • Amplify the ftsK gene from C. burnetii genomic DNA using high-fidelity polymerase

    • Clone into expression vector with N-terminal His-tag

    • Verify sequence accuracy by DNA sequencing

  • Transformation and Expression:

    • Transform plasmid into E. coli expression strain

    • Inoculate transformed cells into LB medium with appropriate antibiotic

    • Grow culture at 37°C until OD600 reaches 0.6-0.8

    • Induce protein expression with 0.5-1 mM IPTG

    • Continue growth at 18-25°C for 16-18 hours (lower temperature improves solubility)

Purification Protocol:

  • Cell Harvest and Lysis:

    • Harvest cells by centrifugation (5,000 × g, 10 min, 4°C)

    • Resuspend pellet in lysis buffer:

      • 50 mM Tris-HCl, pH 8.0

      • 300 mM NaCl

      • 10 mM imidazole

      • 5% glycerol

      • 1 mM DTT

      • Protease inhibitor cocktail

    • Lyse cells using sonication or French press

    • Clarify lysate by centrifugation (20,000 × g, 30 min, 4°C)

  • Affinity Chromatography:

    • Apply clarified lysate to Ni-NTA or cobalt-agarose column

    • Wash column with wash buffer (lysis buffer with 20-30 mM imidazole)

    • Elute protein with elution buffer (lysis buffer with 250-300 mM imidazole)

    • Analyze fractions by SDS-PAGE

  • Additional Purification Steps:

    • Pool protein-containing fractions

    • Perform size-exclusion chromatography to remove aggregates and obtain homogeneous preparation

    • For highest purity, consider ion-exchange chromatography as intermediate step

  • Buffer Exchange and Storage:

    • Exchange into storage buffer:

      • 20 mM Tris-HCl, pH 8.0

      • 150 mM NaCl

      • 6% trehalose

    • Concentrate protein using centrifugal concentrators

    • For long-term storage, add glycerol to 5-50% final concentration

    • Aliquot and store at -80°C, avoiding repeated freeze-thaw cycles

Quality Control:

  • Assess purity by SDS-PAGE (should be >90%)

  • Verify identity by Western blot with anti-His antibody

  • Test activity using ATPase assay

Alternative Approaches:

  • For insoluble protein, refolding protocols may be required

  • For membrane-associated domains, consider detergent solubilization

  • For improved solubility, fusion with MBP or SUMO tags may be beneficial

This protocol can be adapted for expressing specific domains of FtsK by adjusting the amplified region of the gene accordingly.

What methods are available for studying FtsK-mediated DNA translocation?

Several sophisticated methods are available for studying FtsK-mediated DNA translocation, each providing different insights into the mechanism:

Single-Molecule Approaches:

  • Magnetic Tweezers:

    • Attach one end of DNA to glass surface and other end to magnetic bead

    • Apply magnetic field to create tension in DNA molecule

    • Measure FtsK-mediated DNA translocation by bead displacement

    • Provides data on translocation rates, processivity, and force generation

  • Optical Tweezers:

    • Similar to magnetic tweezers but uses laser to trap bead

    • Higher precision than magnetic tweezers

    • Can measure forces generated during translocation

    • Allows detection of single translocation events

  • Tethered Particle Motion (TPM):

    • Attach DNA between surface and bead without external force

    • Monitor Brownian motion of bead as indicator of DNA length

    • FtsK translocation changes effective DNA length, altering bead movement

    • Simpler setup than tweezers approaches

Fluorescence-Based Methods:

  • Total Internal Reflection Fluorescence (TIRF) Microscopy:

    • Label DNA with fluorescent dyes

    • Observe FtsK movement along DNA in real-time

    • Can track individual motor proteins using fluorescently tagged FtsK

    • Reveals processivity and potential pausing sites

  • Fluorescence Resonance Energy Transfer (FRET):

    • Label DNA with donor and acceptor fluorophores

    • FtsK translocation changes distance between fluorophores

    • Monitor FRET efficiency changes over time

    • Provides information about local DNA conformational changes during translocation

Bulk Biochemical Assays:

  • Triplex Displacement Assay:

    • Create DNA triplex by annealing oligonucleotide to specific site on DNA

    • FtsK translocation displaces triplex-forming oligonucleotide

    • Monitor displacement kinetics by fluorescence or gel shift

    • Allows testing of directional bias and sequence preferences

  • DNA Topology-Based Assays:

    • Use supercoiled plasmids containing FtsK loading sites

    • FtsK translocation changes DNA topology

    • Analyze topological changes by gel electrophoresis

    • Can reveal large-scale conformational changes induced by FtsK

ATP Hydrolysis Coupling:

  • Coupled ATPase Assays:

    • Measure ATP hydrolysis rates in presence of different DNA substrates

    • Compare DNA-dependent versus basal ATPase activity

    • Assess coupling between ATP hydrolysis and translocation

    • Use ATP analogs to trap specific states of the translocation cycle

Experimental Design Considerations:

ParameterRecommended ApproachNotes
DNA substrateLinear DNA with defined loading siteInclude KOPS/SRS sequences if studying directionality
Buffer conditions25 mM Tris-HCl pH 7.5, 10 mM MgCl₂, 10% glycerolOptimize salt concentration for specific assay
ATP concentration1-5 mM ATPInclude ATP regeneration system for long experiments
Temperature25-37°CMaintain constant temperature throughout experiment
Protein concentration10-100 nM (hexamer)Concentration depends on specific assay

These methods can be applied to study C. burnetii FtsK translocation properties, which may reveal adaptations specific to this intracellular pathogen compared to well-characterized FtsK proteins from model organisms.

How can researchers screen for small molecule inhibitors of C. burnetii FtsK?

Researchers can employ the following methodological approaches to screen for small molecule inhibitors of C. burnetii FtsK:

Primary Screening Assays:

  • ATP Hydrolysis Assays:

    • High-throughput colorimetric detection of inorganic phosphate release

    • Malachite green assay in 96/384-well format

    • Screen compounds for inhibition of FtsK ATPase activity

    • Counter-screen against control ATPases to ensure specificity

  • Fluorescence-Based DNA Translocation Assays:

    • DNA labeled with fluorophore-quencher pairs

    • FtsK translocation separates fluorophore from quencher

    • Monitor fluorescence increase in real-time

    • Amenable to high-throughput screening in plate format

  • FtsK-XerD Interaction Inhibition:

    • FRET or AlphaScreen assay between labeled FtsK γ domain and XerD

    • Test compounds for disruption of protein-protein interaction

    • Target specific protein-protein interfaces rather than ATPase activity

Secondary Validation Assays:

  • Surface Plasmon Resonance (SPR):

    • Immobilize FtsK on sensor chip

    • Measure direct binding of hit compounds

    • Determine binding kinetics and affinity constants

    • Confirm direct interaction with FtsK

  • Thermal Shift Assays:

    • Monitor protein thermal stability using fluorescent dyes

    • Compound binding typically alters melting temperature

    • Rapid method to confirm direct interaction

    • Requires minimal amounts of protein

  • XerCD-dif Recombination Inhibition:

    • In vitro recombination assay with purified components

    • Monitor FtsK-activated XerCD-dif recombination

    • Test inhibitors for prevention of recombination products

    • More physiologically relevant than ATPase assay alone

Cellular Validation:

  • Bacterial Growth Inhibition:

    • Test compounds against C. burnetii in cell culture infection models

    • Monitor bacterial replication by qPCR or immunofluorescence

    • Compare activity against FtsK mutant strains to confirm target specificity

    • Assess cytotoxicity against host cells to determine selectivity window

  • Microscopy-Based Phenotypic Assays:

    • Observe effects on chromosome segregation and cell division

    • Look for phenocopying of FtsK depletion/mutation

    • Monitor nucleoid organization and segregation defects

    • Use fluorescent reporters to visualize DNA and division machinery

Virtual Screening Approaches:

  • Structure-Based Virtual Screening:

    • Use homology models of C. burnetii FtsK based on solved structures of FtsK homologs

    • Dock compound libraries to ATP-binding site or protein-protein interaction interfaces

    • Prioritize compounds for experimental testing

    • Refine models based on experimental feedback

  • Pharmacophore-Based Screening:

    • Develop pharmacophore models based on known ATPase inhibitors

    • Screen virtual libraries for compounds matching pharmacophore

    • Select diverse representatives for experimental validation

    • Refine model based on structure-activity relationships

Lead Optimization Considerations:

  • Structure-Activity Relationship Studies:

    • Synthesize analogs of hit compounds

    • Test for improved potency and selectivity

    • Optimize physicochemical properties for cellular penetration

    • Balance potency with toxicity profiles

  • Target Selectivity Profiling:

    • Test against panel of related ATPases/translocases

    • Assess activity against human ATP-dependent motor proteins

    • Identify determinants of selectivity for bacterial FtsK

    • Optimize for specificity toward C. burnetii FtsK

This systematic approach would enable identification of specific inhibitors of C. burnetii FtsK that could serve as chemical probes for studying FtsK function and potentially as starting points for antimicrobial drug development against Q fever.

How can recombinant C. burnetii FtsK contribute to vaccine development?

Recombinant C. burnetii FtsK offers several promising avenues for Q fever vaccine development:

Subunit Vaccine Approaches:

  • Recombinant Protein-Based Vaccines:

    • Purified recombinant FtsK or immunogenic domains could serve as vaccine antigens

    • Overcomes safety concerns associated with whole-cell vaccines

    • Less resource-intensive to produce than current formalin-inactivated whole-cell vaccines

    • Can be combined with appropriate adjuvants to enhance immunogenicity

  • Epitope Identification and Selection:

    • Recent reverse vaccinology studies have identified T-cell epitopes from the C. burnetii proteome

    • FtsK epitopes could be included in multi-epitope vaccine formulations

    • Both MHC Class I and Class II epitopes can be predicted for comprehensive immune coverage

    • Cross-species epitope conservation allows development of vaccines effective for both humans and livestock

Advantages of FtsK as a Vaccine Antigen:

  • Essential Protein Target:

    • FtsK is essential for bacterial viability and has conserved functions

    • Antibodies or T-cell responses targeting FtsK could interfere with critical bacterial processes

    • Lower likelihood of immune escape through mutation of conserved functional domains

  • Cross-Protection Potential:

    • Conserved domains of FtsK may provide cross-protection against multiple C. burnetii strains

    • Conservation across isolates reduces risk of vaccine escape mutants

    • May offer broader protection than strain-specific antigens

Research Steps for FtsK-Based Vaccine Development:

  • Immunogenic Domain Identification:

    • Express and purify different domains of C. burnetii FtsK

    • Test immunogenicity in animal models

    • Identify domains that elicit strong antibody and/or T-cell responses

    • Focus on domains accessible to the immune system

  • Epitope Mapping and Prediction:

    • Use bioinformatic tools to predict T-cell epitopes for different host species (humans, sheep, goats, cattle)

    • Verify predicted epitopes through binding assays with MHC molecules

    • Assess peptide processing and presentation using cellular assays

    • Select epitopes with strong binding to multiple MHC alleles

  • Delivery System Development:

    • Test various adjuvant formulations to enhance immunogenicity

    • Explore nanoparticle or virus-like particle platforms for antigen display

    • Consider DNA vaccine approaches encoding FtsK epitopes

    • Develop prime-boost strategies for optimal immune response

Methodological Considerations:

Recent studies have employed reverse vaccinology to identify C. burnetii epitopes for small ruminant hosts . Similar approaches could be applied specifically to FtsK:

MHC ClassPrediction MethodBinding CategoriesHost Species Coverage
Class INetMHCpanStrong (<0.5%), Weak (0.5-2%)Cattle, Sheep, Goats, Humans
Class IINetMHCIIpanStrong (<2%), Weak (2-10%)Cattle, Sheep, Goats, Humans

Using these methods, researchers identified 256 peptides of interest for MHC Class II presentation and 766 peptides for MHC Class I presentation, with 51 peptides predicted to bind both classes . Similar analyses focused on FtsK could identify optimal epitopes for inclusion in subunit vaccines.

The development of FtsK-based subunit vaccines would address the current limitations of Q fever vaccines, including safety concerns and manufacturing challenges associated with whole-cell preparations.

What are the future directions for research on C. burnetii FtsK?

Future research on C. burnetii FtsK presents numerous exciting directions that could advance our understanding of bacterial pathogenesis and potential therapeutic interventions:

Structural and Mechanistic Studies:

  • Cryo-EM Structure Determination:

    • Resolve high-resolution structure of C. burnetii FtsK hexamer

    • Visualize DNA translocation mechanism and conformational changes

    • Compare with FtsK structures from model organisms to identify unique features

    • Use structure to guide rational drug design efforts

  • Single-Molecule Dynamics:

    • Apply advanced biophysical techniques to study real-time DNA translocation

    • Characterize force generation, step size, and processivity

    • Determine directional preference and sequence recognition mechanisms

    • Investigate effects of DNA topology on translocation efficiency

Pathogenesis and Host-Pathogen Interactions:

  • Role in Intracellular Adaptation:

    • Investigate FtsK function during different stages of intracellular infection

    • Determine if FtsK activity is modulated in response to host cell environment

    • Examine potential interactions with host factors during infection

    • Assess contribution to bacterial stress responses within host cells

  • Cell-Type Specific Requirements:

    • Compare FtsK requirements in different host cell types (macrophages vs. epithelial cells)

    • Investigate potential tissue-specific adaptations of FtsK function

    • Determine if FtsK activity varies between acute and chronic infection phases

Technological Innovations:

  • CRISPR-Based Manipulation:

    • Develop improved genetic tools for C. burnetii using CRISPR-Cas systems

    • Generate conditional FtsK mutants to study essentiality

    • Create domain-specific mutations to dissect function in vivo

    • Engineer tagged versions for improved visualization and purification

  • Advanced Imaging Technologies:

    • Apply super-resolution microscopy to visualize FtsK dynamics during infection

    • Develop improved fluorescent protein fusions compatible with C. burnetii physiology

    • Implement correlative light and electron microscopy to connect function with ultrastructure

    • Use live-cell imaging to track chromosome dynamics during bacterial division

Translational Applications:

  • Novel Antimicrobial Development:

    • Screen for specific inhibitors of C. burnetii FtsK

    • Design peptidomimetics targeting the FtsK-XerD interaction

    • Develop DNA mimetics that block FtsK loading or translocation

    • Create combination strategies targeting multiple divisome components

  • Diagnostic Applications:

    • Explore FtsK-derived antigens for improved serological diagnostics

    • Develop DNA aptamers targeting FtsK for diagnostic applications

    • Investigate FtsK as a biomarker for active infection versus past exposure

Comparative Biology:

  • Evolutionary Adaptations:

    • Compare C. burnetii FtsK with homologs from related intracellular pathogens

    • Identify sequence and functional adaptations specific to intracellular lifestyle

    • Investigate horizontal gene transfer events involving ftsK and related genes

    • Study co-evolution of FtsK with interacting partners (XerCD, divisome components)

  • Environmental Persistence:

    • Examine potential role of FtsK in C. burnetii survival in environmental reservoirs

    • Investigate contribution to spore-like small cell variant formation

    • Explore function during transitions between replicative and persistent forms

These future directions represent promising avenues for advancing our understanding of C. burnetii FtsK biology and leveraging this knowledge for improved diagnostics, therapeutics, and vaccines against Q fever.

What are common pitfalls in working with recombinant C. burnetii FtsK and how can they be addressed?

Working with recombinant C. burnetii FtsK presents several common challenges that researchers should anticipate and address:

Expression and Solubility Issues:

ChallengePossible CausesSolutions
Low expression yieldCodon bias, toxicity, mRNA structureUse codon-optimized gene, lower induction temperature (16-18°C), use specialized expression strains (C41/C43)
Protein insolubilityMembrane domains, improper foldingExpress soluble domains only, add solubilizing agents (0.1% Triton X-100, 6% trehalose) , use fusion tags (MBP, SUMO)
Protein degradationProtease sensitivity, instabilityAdd protease inhibitors, reduce expression time, maintain low temperature during purification
Inclusion body formationOverexpression, improper foldingDecrease IPTG concentration, lower temperature, use solubility-enhancing additives

Purification Challenges:

ChallengePossible CausesSolutions
Poor affinity bindingTag inaccessibility, improper bufferIncrease imidazole in binding buffer (10-20 mM), try different affinity tags, adjust pH
Co-purifying contaminantsNon-specific binding, protein complexesIncrease salt concentration (up to 500 mM NaCl), add low concentrations of detergent, include additional purification steps
Loss of activityDenaturation, cofactor lossInclude ATP/Mg²⁺ in buffers, avoid harsh elution conditions, verify activity after each step
Aggregation during concentrationHydrophobic interactions, unfoldingAdd glycerol (5-10%), use step-wise concentration, maintain low temperature

Activity Assay Complications:

ChallengePossible CausesSolutions
No detectable ATPase activityInactive protein, suboptimal conditionsVerify hexamer formation, optimize buffer conditions (pH, salt, Mg²⁺), include DNA to stimulate activity
Non-specific ATPase backgroundContaminating ATPasesImprove purification, use specific inhibitors for common contaminants, validate with no-enzyme controls
Inconsistent DNA translocationDNA quality, protein aggregationUse freshly prepared DNA substrates, optimize protein:DNA ratio, include molecular crowding agents
Poor XerCD activationImproper complex formation, buffer incompatibilityVerify XerD interaction by pull-down, optimize buffer for multiprotein complex, check protein quality

Storage and Stability Issues:

ChallengePossible CausesSolutions
Activity loss during storageDenaturation, aggregation, proteolysisAdd glycerol (5-50%), include stabilizers (trehalose, ATP) , store in small aliquots to avoid freeze-thaw cycles
Precipitation after freeze-thawAggregation during freezingFlash-freeze in liquid nitrogen, thaw quickly at room temperature, add cryoprotectants
Activity variation between preparationsBatch-to-batch inconsistencyStandardize purification protocol, develop quantitative activity assays, pool multiple preparations

Specific Recommendations from Commercial Sources:

According to specifications for commercial recombinant C. burnetii FtsK :

  • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

  • Briefly centrifuge vial before opening to bring contents to bottom

  • Add glycerol (5-50% final) and aliquot for long-term storage

  • Store at -20°C/-80°C for long-term storage

  • Working aliquots can be kept at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles

By anticipating these common pitfalls and implementing the suggested solutions, researchers can improve their success in working with recombinant C. burnetii FtsK for various applications in basic and applied research.

How can researchers validate the functional activity of purified recombinant C. burnetii FtsK?

Researchers can employ multiple complementary approaches to validate the functional activity of purified recombinant C. burnetii FtsK:

ATP Hydrolysis Activity Assays:

  • Malachite Green Phosphate Detection:

    • Reaction mixture: 50 mM Tris-HCl pH 7.5, 10 mM MgCl₂, 1 mM ATP, 50-200 nM FtsK

    • Include DNA substrate to stimulate activity (plasmid or linear DNA)

    • Incubate at 37°C for 15-30 minutes

    • Add malachite green reagent and measure absorbance at 630 nm

    • Compare activity with and without DNA to confirm DNA-dependent stimulation

  • Coupled Enzyme Assay:

    • Reaction mixture: 50 mM Tris-HCl pH 7.5, 10 mM MgCl₂, 1 mM ATP, 0.4 mM NADH, 2 mM PEP, pyruvate kinase, lactate dehydrogenase

    • Monitor decrease in absorbance at 340 nm (NADH oxidation)

    • Real-time continuous assay allows determination of initial rates

    • Calculate specific activity (μmol ATP/min/mg protein)

DNA Binding Assays:

  • Electrophoretic Mobility Shift Assay (EMSA):

    • Incubate purified FtsK with labeled DNA fragments

    • Run on non-denaturing polyacrylamide gel

    • Visualize DNA band shifts indicating protein binding

    • Test DNA fragments with and without putative recognition sequences

  • Fluorescence Anisotropy:

    • Label DNA with fluorescent dye

    • Measure changes in fluorescence anisotropy upon FtsK binding

    • Determine binding constants and stoichiometry

    • Compare binding to different DNA sequences and structures

DNA Translocation Activity:

  • Triplex Displacement Assay:

    • Form DNA triplex by annealing triplex-forming oligonucleotide to target site

    • Add FtsK and ATP to initiate translocation

    • Monitor fluorescence increase as triplex is displaced

    • Confirm ATP-dependence by comparing with non-hydrolyzable ATP analogs

  • DNA Supercoiling Assay:

    • Use relaxed circular DNA as substrate

    • FtsK translocation introduces supercoils

    • Analyze by agarose gel electrophoresis with chloroquine

    • Compare results with known active FtsK proteins from model organisms

XerCD-dif Activation Assays:

  • In Vitro Recombination:

    • Incubate purified XerC, XerD, FtsK with dif-containing DNA

    • Analyze recombination products by gel electrophoresis

    • Confirm ATP-dependence of recombination activation

    • Compare with established recombination systems

  • DNA Cleavage Assay:

    • Use suicide substrates like BSN (bottom-strand nick) DNA

    • FtsK stimulates XerD-mediated cleavage in synaptic complexes

    • Detect covalent protein-DNA complexes by SDS-PAGE

    • Verify that stimulation occurs without ATP if using only the γ subdomain

Oligomeric State Verification:

  • Size-Exclusion Chromatography:

    • Run purified FtsK on calibrated size-exclusion column

    • Active FtsK typically forms hexamers (~450 kDa for full-length)

    • Compare elution profiles with and without ATP/DNA

    • Correlation between hexamer formation and activity

  • Native PAGE Analysis:

    • Run purified FtsK on non-denaturing polyacrylamide gel

    • Compare migration patterns with and without ATP/DNA

    • Active preparations show bands corresponding to hexameric complexes

Validation Controls:

Control TypePurposeImplementation
Negative controlVerify assay specificityUse denatured protein or omit ATP
Positive controlConfirm assay functionalityUse well-characterized FtsK from model organism
Substrate controlsTest substrate qualityUse DNA with/without recognition sequences
Inhibitor controlConfirm specific activityTest ATPase inhibitors (vanadate, AMPPNP)

Expected Activity Parameters:

For properly folded, active C. burnetii FtsK, researchers should expect:

  • DNA-stimulated ATPase activity (3-10 fold over basal activity)

  • Hexamer formation in presence of DNA and nucleotide

  • Ability to activate XerCD-dif recombination in an ATP-dependent manner

  • DNA binding with preference for specific recognition sequences

By applying multiple validation approaches, researchers can comprehensively assess the functional integrity of purified recombinant C. burnetii FtsK preparations.

What are the key insights gained from research on C. burnetii FtsK and what questions remain to be answered?

Key Insights on C. burnetii FtsK:

Research on C. burnetii DNA translocase FtsK has provided valuable insights into bacterial chromosome segregation, cell division, and pathogenesis, though many aspects remain specific to model organisms and await confirmation in C. burnetii:

  • Functional Conservation:

    • C. burnetii FtsK maintains the core functional domains seen in other bacterial FtsK proteins

    • The DNA motor activity, XerCD activation, and role in chromosome segregation appear conserved

    • The protein likely plays essential roles in C. burnetii cell division and genome maintenance

  • Structural Organization:

    • Full-length protein consists of 778 amino acids with distinct functional domains

    • N-terminal membrane-anchored domain, linker region, and C-terminal motor domains

    • The γ subdomain likely interacts with XerD to activate recombination, similar to other bacteria

  • Methodological Advances:

    • Successful expression and purification of recombinant C. burnetii FtsK has been achieved

    • Functional studies of FtsK from related organisms provide templates for C. burnetii work

    • Development of new genetic tools for C. burnetii enables more direct functional studies

  • Potential Therapeutic and Vaccine Applications:

    • FtsK represents a potential antimicrobial target due to its essential functions

    • Peptides derived from FtsK may serve as candidates for subunit vaccine development

    • Understanding FtsK function may inform strategies to combat C. burnetii infections

Unanswered Questions and Future Challenges:

Despite progress, several important questions about C. burnetii FtsK remain to be addressed:

  • C. burnetii-Specific Adaptations:

    • How has FtsK evolved to function within the unique intracellular niche of C. burnetii?

    • Are there adaptations specific to the biphasic lifecycle (small cell variant/large cell variant)?

    • Do the DNA recognition sequences (KOPS/SRS) differ from those in model organisms?

  • Pathogenesis Role:

    • How does FtsK function contribute to C. burnetii virulence and persistence?

    • Is FtsK activity modulated during different stages of infection?

    • Could targeting FtsK effectively attenuate C. burnetii in vivo?

  • Protein Interactions:

    • What is the complete interactome of C. burnetii FtsK?

    • How does FtsK coordinate with other divisome components in this organism?

    • Are there unique interaction partners compared to model organisms?

  • Regulatory Mechanisms:

    • How is FtsK expression and activity regulated during the C. burnetii cell cycle?

    • Are there post-translational modifications that affect FtsK function?

    • How does the intracellular environment influence FtsK activity?

  • Structural Details:

    • What is the high-resolution structure of C. burnetii FtsK?

    • How does the hexameric motor assemble on DNA?

    • What conformational changes occur during the ATP hydrolysis cycle?

  • Therapeutic Potential:

    • Can specific inhibitors of C. burnetii FtsK be developed?

    • Would FtsK inhibition be effective against both acute and chronic forms of Q fever?

    • How can FtsK-derived antigens be optimized for vaccine development?

Technological Barriers to Progress:

Several challenges currently limit progress in C. burnetii FtsK research:

  • Biosafety requirements for working with C. burnetii (BSL-3 pathogen)

  • Limited genetic tools compared to model organisms

  • Difficulty in establishing infection models that recapitulate all aspects of disease

  • Challenges in high-resolution imaging of intracellular bacteria

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.