Recombinant Coxiella burnetii Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to settle the contents. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
msbA; CBU_0856; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-589
Protein Length
full length protein
Species
Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Target Names
msbA
Target Protein Sequence
MKTLTSQGIRTYGRLLQATKQYWPIFLIGVVGMIAVSLSDAGFTWLIKPIINRGFIARDL VFIRWLPFIIVLVFLFRGAANFLSTYFINRVARNIVMDFRRAIFSHLLRLPAEFYDRHSS GHLLSTVIYNVEQVAQASSDALIITLQASSLVVGLLVVMFLVSWKLTLFFLVITPLIAWV MRVCSARLRHLSTSVQKSVGEVTHIASEAIEAYKIVRLYGGQKYENEKFRHATKLNQQRE LKVVVTNSVGTSLVQLLIAIPIAIVLFFATQPSFHVTAGSFASIVSAMIMMLRPVRRLTM VNSYIQKGIAAAESIFKLLDEDVEKDRGERHLVRARGAIEYQGVSFAYDNSKKTILSEIS FSIEPGQMVAIVGRSGAGKSTLINLLPRFYDASTGVIKIDDINIKEFRLQELRNQFGLVS QHTTLFNDTILNNIAYGQAGSIDKRKIIEAARAAHAMEFIEQLPEGLDTVIGENGVRLSG GQRQRIAIARALFKNAPIHILDEATSSLDTHSERHIQAALDNLMDQCTTLVIAHRLSTIE RADWIMVLEEGRLIEKGTHQQLLTLNGAYAELYRMQFAEKPAAMTALDE
Uniprot No.

Target Background

Function
This protein is involved in lipopolysaccharide (LPS) biosynthesis. It translocates lipid A-core from the inner to the outer leaflet of the inner membrane. Transmembrane domains (TMD) form a pore in the inner membrane, and the ATP-binding domain (NBD) is responsible for energy generation.
Database Links
Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of MsbA in Coxiella burnetii lipid A transport?

MsbA in Coxiella burnetii functions as an ABC transporter responsible for the translocation of lipid A from the inner to the outer membrane during lipopolysaccharide (LPS) synthesis. This protein is crucial for the proper assembly of the bacterial outer membrane, which contributes to C. burnetii's ability to survive within host cells. Research has demonstrated that lipid A is significant for optimal development of Coxiella-containing vacuoles and robust multiplication in macrophage-like THP-1 cells, though its role appears less critical in axenic media and non-phagocytic cells . The ATP-binding domain of MsbA provides the energy through ATP hydrolysis for the active transport of lipid A across the membrane, while the permease domain forms the channel through which lipid A molecules pass.

How does C. burnetii MsbA structure compare to homologous proteins in other bacteria?

While the complete three-dimensional structure of C. burnetii MsbA has not been fully characterized in the provided literature, structural analysis would be expected to reveal a homodimeric transporter with each monomer containing a transmembrane domain and a nucleotide-binding domain. The protein likely shares structural similarities with MsbA from other Gram-negative bacteria such as E. coli, but may contain unique adaptations that enable C. burnetii to survive in the acidic environment of its replicative niche. These adaptations could include modifications in the transmembrane helices that interact with lipid A or in the nucleotide-binding domains that power transport. Research on other bacterial species has shown that MsbA undergoes conformational changes between inward-facing, outward-facing, and intermediate states during the transport cycle.

What are the optimal expression systems for producing recombinant C. burnetii MsbA?

For successful expression of recombinant C. burnetii MsbA, researchers have developed specialized expression systems that accommodate the challenges of membrane protein production. The approach typically involves:

  • Expression vectors: Shuttle plasmids have been developed that allow expression of recombinant proteins in C. burnetii . These plasmids can be modified to include fusion tags (such as TEM or CyaA) that facilitate detection of protein translocation.

  • Host systems: While native expression in C. burnetii is possible using developed shuttle vectors, surrogate hosts like L. pneumophila have also been successfully used for expression of C. burnetii proteins . For purification purposes, E. coli expression systems optimized for membrane proteins (such as C41/C43 strains or Lemo21) would likely yield better results.

  • Induction conditions: When using inducible promoters, optimizing inducer concentration, temperature (typically lowered to 16-20°C), and induction time (extended for membrane proteins) are critical for proper folding and membrane insertion.

The selection of an appropriate expression system depends on the intended application, with surrogate bacterial hosts offering higher yields for biochemical studies, while expression in C. burnetii provides more biologically relevant insights into protein function and localization.

What purification strategies yield the highest quality recombinant C. burnetii MsbA for structural studies?

Purification of recombinant C. burnetii MsbA for structural studies requires specific approaches to maintain protein stability and function:

Purification StepMethodCritical ParametersYield/Purity Indicators
Membrane IsolationDifferential centrifugationBuffer pH (7.0-8.0), Protease inhibitorsEnrichment of membrane fraction
SolubilizationDetergent extractionDetergent type (DDM, LMNG preferred), Detergent:protein ratio>80% extraction efficiency
Affinity PurificationIMAC, Strep-tag, FLAG-tagImidazole concentration, Flow rate>90% purity
Size ExclusionSEC columnsBuffer composition, Flow rateMonodisperse peak

The choice of detergent is particularly critical, as it must effectively solubilize MsbA while maintaining its native conformation. For structural studies, additional considerations include:

  • Detergent exchange or reconstitution into nanodiscs/liposomes for cryo-EM studies

  • Addition of stabilizing lipids (phosphatidylethanolamine, cardiolipin)

  • Inclusion of nucleotides (ATP, ADP) to capture specific conformational states

Successful purification is typically verified through analytical SEC profiles, negative stain EM, and functional assays (ATPase activity or lipid flipping assays).

How can researchers measure the ATPase activity of recombinant C. burnetii MsbA?

The ATPase activity of recombinant C. burnetii MsbA can be measured using several complementary approaches:

  • Colorimetric phosphate release assays: This method quantifies inorganic phosphate released during ATP hydrolysis. The malachite green assay is particularly sensitive for detecting nanomolar quantities of phosphate and can be performed in microplate format for high-throughput analysis. Reaction conditions should be optimized for temperature (typically 37°C), pH (optimum likely between 6.0-7.5 considering C. burnetii's acidic niche), and detergent concentration.

  • Coupled enzyme assays: These real-time assays link ATP hydrolysis to NADH oxidation through pyruvate kinase and lactate dehydrogenase, allowing continuous monitoring of ATPase activity by measuring the decrease in NADH absorbance at 340 nm.

  • Radiolabeled ATP assays: Using [γ-32P]ATP provides highly sensitive detection of ATPase activity by measuring the release of radiolabeled phosphate.

For C. burnetii MsbA specifically, researchers should consider:

  • Performing assays at different pH values (5.5-7.5) to reflect the acidic environment of the Coxiella-containing vacuole

  • Including lipid A or LPS substrates to assess substrate-stimulated ATPase activity

  • Comparing basal versus stimulated ATPase activity to understand regulatory mechanisms

Controls should include ATPase inhibitors (vanadate, EDTA) and heat-inactivated protein to distinguish MsbA-specific activity from background.

What experimental approaches can determine if C. burnetii MsbA is essential for bacterial survival?

Determining the essentiality of C. burnetii MsbA requires specialized approaches due to the intracellular lifestyle of this pathogen:

  • Chemical inhibition studies: Research utilizing LpxC inhibitors (such as LPC-011) provides indirect evidence of the importance of lipid A biosynthesis and transport for C. burnetii survival . Similar approaches with specific MsbA inhibitors could help establish the protein's essentiality. Data from LpxC inhibitor studies suggest varying dependency on lipid A in different culture conditions, with macrophage-like THP-1 cells showing the most pronounced growth defects under inhibition .

  • Genetic approaches:

    • Conditional knockdown systems using tetracycline-responsive promoters

    • CRISPR interference (CRISPRi) for gene repression

    • Transposon mutagenesis libraries with deep sequencing (Tn-seq) to identify essential genes

  • Surrogate systems: Assessing the ability of C. burnetii MsbA to complement E. coli or L. pneumophila msbA mutants could provide insights into functional conservation and essentiality.

  • Phenotypic analysis: Monitoring bacterial growth, vacuole formation, and intracellular replication in various cell types under controlled expression conditions. Evidence suggests that lipid A plays varying roles in different host cell types, with more significant effects observed in macrophage-like cells compared to non-phagocytic cells .

Success in these approaches requires careful consideration of C. burnetii's unique growth requirements and the development of the Coxiella-containing vacuole (CCV) as a replicative niche.

How does MsbA contribute to C. burnetii's ability to survive in acidic phagolysosomes?

C. burnetii uniquely thrives in acidic phagolysosomes, and MsbA likely plays a critical role in this adaptation:

  • Maintenance of membrane integrity: By facilitating proper lipid A transport, MsbA helps maintain the structural integrity of the outer membrane under acidic conditions. Research has shown that C. burnetii can replicate in phagocytic vacuoles in low pH environments , suggesting adaptations in membrane components and their transport systems.

  • Modified lipid A composition: C. burnetii may modify its lipid A structure to better withstand acidic environments, with MsbA potentially evolved to transport these modified substrates efficiently. Studies have demonstrated that inhibiting lipid A biosynthesis affects C. burnetii's ability to form productive vacuoles, particularly in macrophage-like THP-1 cells .

  • pH-dependent activity regulation: MsbA might have evolved pH-dependent conformational changes or activity regulation, optimizing its function in the acidic environment of the Coxiella-containing vacuole (pH 4.5-5.0).

  • Contribution to phase variation: C. burnetii undergoes phase variation involving changes in LPS structure. MsbA could play a role in this process, which affects virulence and host cell interaction. Research indicates that while full-length LPS of phase I C. burnetii tends to become truncated during extensive cell culture passage, lipid A remains unaffected, suggesting selective pressure to retain this component .

The significance of lipid A and associated transport systems varies across different growth conditions, with more pronounced effects observed in macrophage-like cells compared to non-phagocytic cells or axenic media , indicating context-dependent functions of MsbA in C. burnetii pathogenesis.

What is the relationship between MsbA function and T4SS effector translocation in C. burnetii?

The relationship between MsbA function and Type IV Secretion System (T4SS) effector translocation in C. burnetii involves several potential interconnections:

  • Membrane organization and T4SS assembly: Proper lipid A transport by MsbA contributes to outer membrane organization, which may be critical for T4SS assembly and function. Research has established that C. burnetii harbors a T4SS highly similar to the Dot/Icm system of L. pneumophila that is essential for its infectivity .

  • Energy coupling: Both MsbA and T4SS require ATP hydrolysis for their functions, potentially creating competition for cellular energy resources.

  • Vacuole biogenesis coordination: The T4SS secretes effectors that facilitate the biogenesis of a phagosome permissive for intracellular growth , while MsbA contributes to membrane integrity and possibly to vacuole interactions. Studies have identified at least 32 substrates of the C. burnetii Dot/Icm system , and the proper function of both the T4SS and MsbA may be necessary for optimal vacuole formation.

  • Temporal regulation during infection: Expression and activity of MsbA and T4SS components may be coordinately regulated during different stages of infection.

Experimental approaches to investigate this relationship include:

  • Analyzing T4SS effector translocation efficiency under conditions of MsbA inhibition

  • Examining membrane microdomain composition when MsbA function is altered

  • Studying potential protein-protein interactions between MsbA and T4SS components

  • Comparing transcriptional profiles of msbA and T4SS genes during infection

How can researchers identify and evaluate specific inhibitors of C. burnetii MsbA?

Identifying and evaluating specific inhibitors of C. burnetii MsbA involves a systematic approach:

  • In silico screening:

    • Structure-based virtual screening using homology models of C. burnetii MsbA

    • Pharmacophore-based screening targeting ATP-binding site or substrate-binding regions

    • Molecular dynamics simulations to identify unique binding pockets

  • Biochemical screening assays:

    • ATPase inhibition assays using purified recombinant MsbA

    • Lipid A transport assays in reconstituted systems

    • Thermal shift assays to identify compounds that alter protein stability

  • Cellular validation:

    • Growth inhibition assays in axenic media and cell culture models

    • Monitoring lipid A transport using modified lipid substrates

    • Assessment of membrane integrity under inhibitor treatment

  • Specificity determination:

    • Comparison of inhibition profiles against MsbA from other bacterial species

    • Selectivity screening against human ABC transporters

    • Structure-activity relationship studies to improve specificity

Research on LpxC inhibitors against C. burnetii has shown that inhibitor effectiveness varies across different culture systems, with more pronounced effects in macrophage-like THP-1 cells compared to non-phagocytic cells . Similar variability might be expected for MsbA inhibitors, necessitating testing across multiple physiologically relevant conditions.

What are the considerations for developing MsbA inhibitors as potential anti-C. burnetii agents?

Development of MsbA inhibitors as potential anti-C. burnetii agents must address several key considerations:

  • Pharmacokinetic challenges:

    • Stability in cellular environments (studies with LpxC inhibitor LPC-011 showed that regular media changes were required for sustained inhibition)

    • Penetration into infected cells and the Coxiella-containing vacuole

    • Half-life compatible with C. burnetii's long developmental cycle

    • Appropriate administration routes for treating systemic infections

  • Target specificity:

    • Selectivity over human ABC transporters to minimize toxicity

    • Specificity for C. burnetii MsbA over commensal bacteria MsbA

    • Consideration of effects on host-microbiome interactions

  • Resistance development:

    • Potential for target mutations affecting inhibitor binding

    • Alternate pathways for lipid A transport or modification

    • Evaluation of resistance frequency and mechanisms

  • Efficacy parameters:

    • Efficacy in different infection models (acute vs. chronic)

    • Synergy with current standard treatments (doxycycline, hydroxychloroquine)

    • Effectiveness against both phase I and phase II strains

  • Special populations:

    • Safety and efficacy in pregnant patients (Q fever can cause adverse fetal outcomes)

    • Considerations for immunocompromised patients at higher risk

Research with LpxC inhibitors has provided insights that would inform MsbA inhibitor development, showing varied effects across different culture systems and suggesting that inhibition of lipid A biosynthesis and transport machinery could be a viable therapeutic approach, particularly for infections involving macrophage-like cells .

How can researchers utilize recombinant C. burnetii MsbA for vaccine development strategies?

Utilizing recombinant C. burnetii MsbA for vaccine development involves several strategic approaches:

  • Subunit vaccine development:

    • Expression and purification of immunogenic MsbA domains (particularly extracellular loops)

    • Formulation with appropriate adjuvants to enhance immunogenicity

    • Evaluation of antibody responses that might neutralize MsbA function

  • Live attenuated vaccine approaches:

    • Creating C. burnetii strains with modified MsbA function (reduced but not eliminated)

    • Generating strains that expose normally hidden MsbA epitopes

    • Using attenuated strains as delivery vehicles for MsbA epitopes

  • Evaluation metrics:

    • Antibody titer measurement using enzyme-linked immunosorbent assays

    • Functional assays to assess antibody-mediated inhibition of MsbA activity

    • Challenge studies to determine protective efficacy in animal models

A Q fever vaccine is currently available in Australia for those with high occupational risk , but improved vaccines targeting essential proteins like MsbA could potentially offer broader protection. Research approaches should consider the distinct immune responses to phase I versus phase II C. burnetii and address the challenge of inducing long-lasting protective immunity without adverse reactions.

How do mutations in the C. burnetii msbA gene correlate with antibiotic resistance and virulence phenotypes?

The correlation between C. burnetii msbA mutations and phenotypes of antibiotic resistance and virulence requires sophisticated analytical approaches:

  • Mutation identification:

    • Whole genome sequencing of field isolates with varied antibiotic susceptibility profiles

    • Site-directed mutagenesis to introduce specific mutations in laboratory strains

    • RNA-seq analysis to identify compensatory changes in gene expression

  • Phenotypic characterization:

    • Minimum inhibitory concentration (MIC) determinations for various antibiotics

    • Growth kinetics in axenic media and cell culture models

    • Virulence assessment in appropriate animal models

  • Structure-function analysis:

    • Mapping mutations to functional domains of MsbA

    • Biophysical characterization of mutant proteins (stability, ATPase activity)

    • Molecular dynamics simulations to predict effects on protein function

  • Clinical correlations:

    • Analysis of treatment outcomes for patients infected with strains carrying msbA mutations

    • Epidemiological studies of strain distribution in endemic areas

    • Assessment of correlation between mutations and chronic infection establishment

Research suggests that C. burnetii has variable requirements for lipid A in different environments , which may influence the selection pressure on msbA and the emergence of mutations affecting both antibiotic resistance and virulence. The observation that C. burnetii can maintain different LPS structures (phase variation) while retaining lipid A suggests potential flexibility in the lipid A transport system that could be exploited during adaptation to antibiotic pressure or different host environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.