Recombinant Coxiella burnetii Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Functional Roles

YidC operates in two pathways:

PathwaySubstratesMechanism
YidC-onlyPf3 coat protein, M13 procoat, ATP synthase subunit cDirect insertion via the hydrophilic groove .
YidC-Sec complexMulti-pass membrane proteins (e.g., SecG)Assists SecYEG in lateral movement of TM segments .

Expression Systems

Recombinant YidC is typically expressed in heterologous systems (e.g., E. coli) due to challenges in C. burnetii genetic manipulation. Key steps include:

  1. Cloning: Amplification of yidC from C. burnetii genomic DNA.

  2. Purification: Affinity chromatography (e.g., His-tag) followed by detergent solubilization .

  3. Reconstitution: Insertion into proteoliposomes for functional studies .

Functional Validation

In vitro assays demonstrate YidC’s sufficiency in membrane insertion:

  • Pf3 coat protein: Insertion efficiency ~70% in YidC-containing liposomes .

  • Membrane potential dependence: Enhanced insertion with ΔΨ .

Functional Partners in Coxiella burnetii

YidC interacts with core components of the Sec translocon and auxiliary proteins, as inferred from E. coli and C. burnetii interaction networks :

PartnerRoleInteraction Score
FtsYSRP receptor for targeting nascent chains0.987
SecAATP-driven translocase motor0.985
SecYCore translocon subunit0.980
YajCSecDF-YajC-YidC supercomplex component0.973

Mechanistic Insights

  • Substrate binding: YidC’s hydrophilic groove binds hydrophilic regions transiently, while the greasy slide anchors TM segments .

  • Kinetics: Pf3 insertion occurs in two phases: rapid binding (~2 ms) followed by stable insertion (~52 ms) .

Diagnostic and Therapeutic Potential

While C. burnetii YidC is not a current diagnostic target, its structural conservation with E. coli YidC suggests potential as:

  • Antibiotic target: Inhibitors of the hydrophilic groove could disrupt membrane protein biogenesis .

  • Vaccine adjuvant: Modulation of YidC activity may enhance protein folding for vaccine antigens (e.g., Com1, Mip) .

Gaps and Future Directions

  • Direct characterization: No studies explicitly address C. burnetii YidC’s recombinant form.

  • Pathogenicity: Role in C. burnetii virulence (e.g., intracellular replication) remains unexplored.

  • Structural studies: Cryo-EM or X-ray crystallography data are needed to resolve C. burnetii YidC’s conformation.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of your specified tag.
Synonyms
yidC; CBUD_0201; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-566
Protein Length
full length protein
Species
Coxiella burnetii (strain Dugway 5J108-111)
Target Names
yidC
Target Protein Sequence
MDIKRIILYVIVALLAIALFNAWQRDYPPTPKPTPTVEQPTANGDHPTAYTPPAFTPGAA EKTKKAGTIALTSKVPEARLITVRTDVLDVEIDTQGGNIVSAKLPKYPVSLEEKQTPVQI LSGEPNELYVAQSGLTNGNGQPTTVQFESAKKQYVLENGQNQLIVQLTGRAPDGLLVTKT YTFHRDDYAIHLAYQVKNNTSKPWQGSLYTQITRRQPPTEHHHFYVRSYNGASMGSPQTP YEKLSYESLDKQNIDRTSQSGWIAMQQHYFLSAWVPGNPELTYHYYSHVIPASGEPNVYV VGFVSPQMNVAAGSEAATHATLYVGPEIAKRLKGLAPGLERTIDYGWLWPISMLLFWILS SVHAVVKNWGWSIIITTILIKIVFYWFSAKSFRSMARMREMQPRIQALKERHGDDRQALS RATMELYRKEKINPLGGCLPMLIQVPVFIAFYYVIIESVQLRQAPFIFWIHDLSVKDPYY ILPIIMGLSMLAQQWLSPTSPDPTQQKMMWILPVIFTVFFINFPAGLVLYWITNNVVQTL QQWYVNKTYESHKAKLKARRARKRKR
Uniprot No.

Target Background

Function
Essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Assists in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Coxiella burnetii and why is YidC significant in this organism?

Coxiella burnetii is the etiological agent of Q fever, a zoonotic disease that can cause both acute and chronic infections in humans. The bacterium is characterized by its ability to replicate in acidic vacuoles resembling the lysosomal network . C. burnetii naturally infects livestock including goats, sheep, and cattle, with fewer than 1,000 human cases reported annually in the United States .

YidC is a universally conserved membrane protein insertase that mediates the integration of membrane proteins into the cytoplasmic membrane, either individually or in concert with the SecY complex . In C. burnetii, as in other bacteria, YidC plays a crucial role in the proper insertion and folding of membrane proteins, which are essential for cellular functions including respiration, energy metabolism, and pathogenesis.

What is the general structure and function of YidC protein?

YidC protein consists of five conserved transmembrane domains with a distinctive arrangement. Structural models based on evolutionary co-variation analysis, lipid-versus-protein-exposure, and molecular dynamics simulations reveal a helical hairpin between transmembrane segment 2 (TM2) and TM3 on the cytoplasmic membrane surface . This arrangement is critical for its function as a membrane protein insertase.

Functionally, YidC interacts with the ribosome at the ribosomal tunnel exit, providing a site for membrane protein insertion at the YidC protein-lipid interface . During co-translational insertion, YidC receives nascent membrane proteins emerging from the ribosome and facilitates their proper integration into the lipid bilayer. This process is essential for bacterial viability and represents a potential target for antimicrobial development.

How does YidC facilitate membrane protein insertion?

YidC facilitates membrane protein insertion through several mechanisms revealed by molecular dynamics simulations and structural studies:

  • Membrane thinning: YidC induces significant thinning (7-10 Å) of the lipid bilayer due to hydrophobic mismatch between the transmembrane helices and the membrane. This thinning is particularly pronounced near TM3 and TM5, which have been identified as contact points for inserting substrate proteins .

  • Hydrophilic environment: YidC creates a hydrophilic environment on the cytoplasmic side of its transmembrane bundle, which transitions to a hydrophobic cluster of aromatic residues toward the periplasmic side. This arrangement likely helps polar termini and loops of substrate proteins cross the hydrophobic core of the thinned lipid bilayer .

  • Ribosome interaction: Single copies of YidC interact directly with the ribosome at the exit tunnel, positioning the nascent membrane protein for proper insertion into the membrane at the YidC-lipid interface .

What techniques are most effective for studying the structure-function relationship of recombinant C. burnetii YidC?

Multiple complementary approaches are necessary for comprehensive structure-function analysis of C. burnetii YidC:

  • Evolutionary co-variation analysis: This computational technique identifies amino acid pairs that co-evolve, providing insights into residue interactions that maintain protein structure and function. For YidC, this approach has successfully predicted the arrangement of transmembrane domains .

  • Molecular dynamics (MD) simulations: MD simulations assess protein stability and biochemical properties in the bacterial membrane. For YidC, these simulations revealed critical inter-residue interactions within the transmembrane region, identifying key residues involved in protein stabilization .

  • In vivo complementation assays: Creating alanine mutants of predicted functionally important residues (identified through MD simulations) allows for assessment of their role in YidC activity. Critical residues such as T362 in TM2 and Y517 in TM6 completely inactivate YidC when mutated to alanine .

  • Cryo-electron microscopy: This technique provides structural insights into YidC-ribosome complexes during co-translational membrane protein insertion, revealing interaction interfaces and conformational states .

How can researchers safely work with C. burnetii-derived proteins?

When working with C. burnetii-derived proteins, researchers should implement several safety measures:

  • Use attenuated strains: Scientists have developed weakened forms of C. burnetii for scientific research. Recently, researchers identified genetic mutations responsible for increased virulence in some laboratory strains and created safer forms of the bacteria without these genetic flaws .

  • Biosafety level selection: Work with recombinant C. burnetii proteins should be conducted in appropriate biosafety level facilities based on risk assessment. While purified recombinant proteins generally pose minimal risks, expression systems using live organisms require careful consideration.

  • Monitoring phase variation: The lipopolysaccharide (LPS) form of C. burnetii, known as "phase variation," significantly influences the bacterium's virulence. Researchers should monitor LPS phase to ensure consistent safety profiles of laboratory strains .

  • Containment measures: Since C. burnetii infection typically occurs through inhalation of contaminated dust particles, appropriate containment measures should be implemented to prevent aerosol generation during experimental procedures .

How can protein-protein interaction mapping be utilized to understand YidC function in C. burnetii?

Protein-protein interaction (PPI) mapping provides crucial insights into YidC function within the broader context of C. burnetii pathogenesis. The following methodological approach can be implemented:

  • Affinity tag purification mass spectrometry (AP-MS): This technique has successfully generated comprehensive C. burnetii-human protein-protein interaction maps. A similar approach can be applied to YidC, using tagged recombinant protein to identify interaction partners in both bacterial and host contexts .

  • Validation through complementary techniques: Potential interactions identified through AP-MS should be validated using techniques such as co-immunoprecipitation, bacterial two-hybrid systems, or fluorescence resonance energy transfer (FRET).

  • Functional analysis of interaction networks: Once interaction partners are identified, functional analysis can reveal how YidC contributes to various cellular processes. As demonstrated with other C. burnetii effectors like CBU0425 (CirB), such analyses can uncover unexpected functions, such as modulation of host proteasome activity .

What are the critical residues in C. burnetii YidC that determine its functionality?

Based on molecular dynamics simulations and in vivo complementation assays with E. coli YidC (which shares conserved features with C. burnetii YidC), several critical residues determine functionality:

Table 1: Critical Residues in YidC and Their Functional Significance

ResidueLocationEffect of Alanine MutationFunctional Significance
T362TM2Complete inactivationCore stabilization at membrane interface
Y517TM6Complete inactivationCore stabilization at membrane interface
F433TM regionIntermediate activity reductionMembrane protein interaction
M471TM regionIntermediate activity reductionMembrane protein interaction
F505TM regionIntermediate activity reductionMembrane protein interaction

The critical nature of T362 and Y517 suggests they form essential stabilizing interactions within the YidC core structure, while residues showing intermediate effects likely participate in substrate recognition or processing .

How does membrane composition affect YidC-mediated protein insertion in C. burnetii?

C. burnetii must adapt to the harsh environment of the acidic lysosome-like compartment during infection, which likely influences membrane composition and YidC function:

  • Membrane thinning effects: YidC induces thinning of the lipid bilayer by 7-10 Å due to hydrophobic mismatch between transmembrane helices and the membrane. This thinning is crucial for insertion of substrate proteins, particularly in the regions near TM3 and TM5 .

  • Hydrophilic-hydrophobic transitions: The distribution of hydrophilic and hydrophobic residues within YidC creates a specialized environment that facilitates the transfer of polar termini and loops of substrate proteins across the hydrophobic core of the lipid bilayer .

  • Adaptation to acidic environment: The unique membrane composition of C. burnetii, adapted to survive in acidic environments, likely influences YidC functionality. Research methodologies exploring these adaptations would include lipidomic analysis of C. burnetii membranes under different pH conditions and reconstitution of YidC in liposomes with varying lipid compositions.

How can understanding YidC contribute to new diagnostic and vaccine development for Q fever?

YidC, as an essential membrane protein insertase, influences the proper localization of numerous C. burnetii membrane proteins, including potential immunogenic proteins that could serve as diagnostic markers or vaccine candidates:

  • Identification of YidC-dependent immunogenic proteins: Comparative proteomic analysis of wild-type versus YidC-depleted C. burnetii can identify membrane proteins dependent on YidC for proper insertion. These proteins may represent novel diagnostic or vaccine targets.

  • Seroreactive protein analysis: Recent immunoproteomic studies have identified numerous C. burnetii seroreactive proteins that could serve as the basis for new Q fever diagnostic tests and vaccines. Understanding YidC's role in the proper presentation of these immunogenic proteins could enhance their diagnostic or vaccine potential .

  • Rational design approach: Structural knowledge of YidC-mediated protein insertion can guide the design of recombinant antigens that maintain native conformations, potentially improving both diagnostic sensitivity and vaccine efficacy compared to current approaches .

What methodological challenges exist in developing C. burnetii diagnostic tests using recombinant membrane proteins?

Several methodological challenges must be addressed when developing diagnostic tests using recombinant C. burnetii membrane proteins that are YidC substrates:

  • Protein conformational integrity: Maintaining the native conformation of membrane proteins during recombinant expression and purification is challenging. YidC-dependent proteins may require specialized expression systems that include YidC co-expression to ensure proper folding.

  • Sensitivity and specificity balancing: Current diagnostic techniques for C. burnetii infection have suboptimal sensitivity, limiting reliable identification of infected animals and timely implementation of countermeasures. Recombinant membrane proteins must be selected and validated for both sensitivity and specificity .

  • Host species variability: Immunogenic protein recognition varies between host species, requiring comprehensive validation across different potential hosts. This is particularly important for zoonotic pathogens like C. burnetii, where diagnostic tests may need to perform consistently in both animal reservoirs and human patients .

What are promising future research directions for C. burnetii YidC?

Several promising research directions could advance our understanding of C. burnetii YidC and its potential applications:

  • Comparative analysis with homologs: Detailed comparison of C. burnetii YidC with homologs from other bacteria, mitochondria (Oxa1), and chloroplasts (Alb3) could reveal unique features that might be targeted for specific antimicrobial development .

  • YidC-dependent proteome characterization: Comprehensive identification of C. burnetii membrane proteins that require YidC for insertion would provide insights into the protein's role in bacterial physiology and pathogenesis.

  • Structure-based drug design: The unique features of the YidC hydrophilic cavity and its essential role in bacterial viability make it a potential target for novel antimicrobials. High-resolution structural data could facilitate rational drug design targeting this conserved bacterial protein.

  • In vivo dynamics during infection: Investigating how YidC function and substrate specificity might change during different stages of C. burnetii infection could reveal adaptation mechanisms essential for pathogenesis.

How might YidC research contribute to understanding C. burnetii adaptation to different environments?

C. burnetii must adapt to drastically different environments during its lifecycle, from the extracellular environment to the acidic lysosome-like vacuole:

  • Differential membrane protein expression: YidC likely plays a critical role in inserting environment-specific membrane proteins required for adaptation to different conditions. Characterizing the YidC-dependent membrane proteome under various conditions could reveal adaptation mechanisms.

  • Stress response mediation: Environmental stressors often trigger changes in membrane protein composition. YidC's role in facilitating these membrane proteome changes represents an important research direction for understanding bacterial stress adaptation.

  • Small cell variant (SCV) to large cell variant (LCV) transition: C. burnetii transitions between these two morphologically distinct forms during its lifecycle. Understanding how YidC contributes to the membrane remodeling required for this transition could provide insights into this unique aspect of C. burnetii biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.