Recombinant Coxiella burnetii Probable disulfide formation protein (CBUD_0951)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant CBUD_0951 is synthesized in Escherichia coli expression systems, followed by purification via standard chromatographic methods .

Production ParameterSpecification
Expression SystemE. coli
Purity>85% (verified by SDS-PAGE)
Storage Conditions- Liquid: 6 months at -20°C/-80°C
- Lyophilized: 12 months at -20°C/-80°C
ReconstitutionDeionized sterile water with optional glycerol (5–50%) for stability
Stability ConsiderationsAvoid repeated freeze-thaw cycles; working aliquots stable at 4°C for 1 week

Functional Role in Bacterial Physiology

CBUD_0951 is hypothesized to function analogously to E. coli DsbB, which regenerates oxidized DsbA by transferring electrons to the quinone pool . This redox relay ensures proper folding of secreted proteins, including virulence factors. Key insights include:

  • Pathogen Survival: Disulfide bond formation is critical for C. burnetii proteins involved in host cell invasion and immune evasion .

  • Inhibition Potential: Targeting DsbB homologs (like CBUD_0951) could disrupt bacterial virulence, as shown in E. coli studies where DsbB inhibitors reduced pathogenicity .

Diagnostic Development

While CBUD_0951 has not been directly tested in serodiagnostic assays, other C. burnetii recombinant proteins (e.g., Com1, CBU_1718) show utility in ELISA-based diagnostics . CBUD_0951’s immunogenicity remains unexplored but could complement existing antigen panels.

Vaccine Studies

A mixture of eight recombinant C. burnetii proteins failed to confer protection in murine models , highlighting the need for further investigation into CBUD_0951’s efficacy as a vaccine candidate.

Comparative Analysis of Disulfide Bond Systems

CBUD_0951’s function aligns with conserved disulfide bond formation pathways across species :

Organism/CompartmentOxidase (e.g., DsbB)Reductase/IsomeraseCofactor
C. burnetii (Periplasm)CBUD_0951 (DsbB homolog)Unidentified DsbC homologUbiquinone
E. coli (Periplasm)DsbBDsbC/DsbGUbiquinone
Human (Endoplasmic Reticulum)Ero1PDIFAD

Challenges and Future Directions

  • Functional Validation: Direct evidence of CBUD_0951’s role in C. burnetii pathogenesis is lacking. Knockout studies could clarify its contribution to virulence.

  • Diagnostic Potential: Screening human and animal sera for anti-CBUD_0951 antibodies may reveal its utility in Q fever diagnostics .

  • Therapeutic Targeting: Small-molecule inhibitors of CBUD_0951 could be explored, leveraging synthetic lethality strategies observed in E. coli .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your needs whenever possible.
Lead Time
Delivery time may vary depending on your location and purchasing method. Please consult your local distributor for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs. For dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type preferences, please inform us, and we will prioritize developing the specified tag.
Synonyms
CBUD_0951; Probable disulfide formation protein; Disulfide oxidoreductase; Thiol-disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Coxiella burnetii (strain Dugway 5J108-111)
Target Names
CBUD_0951
Target Protein Sequence
MMVSRLLKNYSLYFAWLTALIATLGSLYLSLVRHIPVCDLCWYQRVCIYPLTILLGIAAY RTDRGVVKYALPLVVLGFLFSVYQYLQQMIPGFAPINLCGSTSPHCSEIHWEIFGFITLP FLGMLATLIMSFFLIMAFYSLDKRLAN
Uniprot No.

Target Background

Function
Essential for the formation of disulfide bonds in certain proteins.
Database Links
Protein Families
DsbB family, BdbC subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Coxiella burnetii and its clinical significance?

Coxiella burnetii is a gram-negative intracellular bacterium that naturally infects livestock including goats, sheep, and cattle. It causes Q Fever in humans, a rare disease with fewer than 1,000 cases reported annually in the United States . Primary infection typically presents with mild-to-severe flu-like symptoms and can be treated with antibiotics. In some cases, patients may develop pneumonia or hepatitis as manifestations of severe disease . Notably, fewer than 5% of infected individuals progress to chronic Q fever, which develops months or years after initial infection and requires extended antibiotic treatment, with potential fatal outcomes if left untreated . Research interest in Coxiella burnetii has intensified due to its persistence mechanisms and immune evasion strategies.

What is the function of Probable disulfide formation protein (CBUD_0951) in Coxiella burnetii?

The Probable disulfide formation protein (CBUD_0951) is identified as a thiol-disulfide oxidoreductase . Based on its amino acid sequence and predicted functionality, this protein likely catalyzes the formation of disulfide bonds in bacterial proteins, which is critical for proper protein folding and stability . The protein contains characteristic CXXC motifs typically found in thioredoxin-like proteins that participate in redox reactions. The amino acid sequence indicates it contains transmembrane regions, suggesting it may be involved in processing proteins in the bacterial membrane or periplasmic space . This protein may contribute to bacterial virulence by ensuring proper folding of secreted virulence factors or surface proteins involved in host-pathogen interactions.

How does the recombinant form of CBUD_0951 differ from its native state?

The recombinant form of CBUD_0951 is produced in expression systems, typically E. coli, to facilitate laboratory investigation . While the amino acid sequence remains identical to the native protein, several key differences exist: 1) The recombinant protein often includes tag sequences to aid in purification and detection; 2) Post-translational modifications present in the native state may be absent in recombinant forms; 3) The recombinant protein may represent partial sequences rather than the full-length protein, as indicated in commercial products ; and 4) The three-dimensional structure may differ slightly due to the expression environment. These differences must be considered when interpreting experimental results using recombinant proteins, particularly when studying functionality that depends on proper folding or membrane integration.

What experimental models are suitable for investigating CBUD_0951 function in pathogenesis?

When investigating CBUD_0951's role in pathogenesis, researchers should consider both in vitro and in vivo experimental models. For in vitro studies, human macrophage cell lines serve as the primary target cells for Coxiella burnetii infection. For in vivo models, transgenic mice constitutively expressing IL-10 in macrophages have proven particularly valuable . These mice exhibit sustained tissue infection and strong antibody responses following Coxiella burnetii inoculation, mimicking chronic Q fever pathogenesis . This model is considered superior to standard mouse models because IL-10 overexpression creates conditions that prevent bacterial clearance, similar to what occurs in chronic human infections. Experimental approaches should include:

Experimental ApproachApplicationAdvantagesLimitations
Macrophage infection assaysDetermine intracellular survivalDirect assessment of protein's role in cellular infectionLimited to single cell type interactions
IL-10 transgenic miceModel chronic infectionPhysiologically relevant, mimics human chronic Q feverGenetic modification may introduce confounding factors
Gene knockout/complementationDetermine protein essentialityDirect functional assessmentTechnical challenges with Coxiella genetic manipulation
Protein-protein interaction studiesIdentify binding partnersReveals functional networksMay not reflect in vivo conditions

Researchers should note that BSL3 containment is required for work with virulent Coxiella burnetii, though attenuated strains have been developed for research purposes .

What purification methods yield highest activity for Recombinant CBUD_0951?

Obtaining high-quality, active Recombinant CBUD_0951 requires careful consideration of expression and purification strategies. Based on available information on similar bacterial disulfide formation proteins, the following methodological approach is recommended:

  • Expression System Selection: E. coli BL21(DE3) with pET vector systems provide high yields, though consideration should be given to the reducing environment of E. coli cytoplasm which may inhibit proper disulfide bond formation .

  • Induction Conditions: IPTG induction at lower temperatures (16-20°C) for extended periods (16-20 hours) typically enhances proper folding of disulfide-containing proteins.

  • Purification Strategy:

    • Initial capture using affinity chromatography (His-tag or GST-tag commonly used)

    • Intermediate purification via ion exchange chromatography

    • Polishing step using size exclusion chromatography

  • Buffer Optimization: Maintaining redox potential is critical; buffers containing controlled ratios of reduced/oxidized glutathione or DTT/DTNB can help maintain protein in its native conformation.

  • Activity Preservation: The addition of 50% glycerol to the final formulation enhances protein stability during storage at -20°C or -80°C . Repeated freeze-thaw cycles should be avoided, and working aliquots should be stored at 4°C for no more than one week .

The purified protein should be assessed for proper folding using circular dichroism and for enzymatic activity using appropriate thiol-disulfide exchange assays.

How can researchers effectively study the interaction between CBUD_0951 and host immune responses?

Studying CBUD_0951's interaction with host immune responses requires a multi-faceted approach integrating molecular and immunological techniques. Research on Coxiella burnetii indicates that IL-10 plays a crucial role in establishing persistent infections . To investigate CBUD_0951's specific role:

  • Macrophage Response Profiling: Compare transcriptional responses of wild-type and IL-10 overexpressing macrophages when exposed to purified CBUD_0951 or Coxiella burnetii strains with and without this protein. Key markers to assess include:

    • Arginase-1, mannose receptor, and Ym1/2 (markers of alternative macrophage activation)

    • Inducible NO synthase and inflammatory cytokines (markers of classical activation)

  • Cytokine Production Analysis: Measure IL-10, IL-12p40, IL-23p19, and other relevant cytokines to determine how CBUD_0951 might modulate the immune response.

  • Protein-TLR Interaction Studies: Investigate potential interactions between CBUD_0951 and Toll-like receptors or other pattern recognition receptors using co-immunoprecipitation and surface plasmon resonance.

  • In Vivo Granuloma Formation: The number of granulomas in tissues can serve as an indicator of immune response quality, as reduced granuloma formation correlates with chronic infection in IL-10 transgenic mice .

Researchers should compare wild-type and mutant bacteria lacking functional CBUD_0951 to determine its specific contribution to immune modulation and persistence.

What safety precautions are necessary when working with Coxiella burnetii and its recombinant proteins?

Safety considerations are paramount when working with Coxiella burnetii due to its classification as a potential bioterrorism agent and its ability to cause Q fever. While recombinant proteins generally pose lower risks than live bacteria, comprehensive safety measures include:

  • Biosafety Level Requirements:

    • Live virulent Coxiella burnetii requires BSL3 facilities

    • Attenuated strains may be handled at BSL2, though institutional guidelines may vary

    • Recombinant proteins can typically be handled at BSL1 or BSL2, depending on the protein's function

  • Sample Inactivation Protocols: When processing infected tissues, validated inactivation protocols should be implemented. These typically include:

    • Tissue grinding under BSL3 conditions

    • Addition of ATL buffer and proteinase K

    • Heat inactivation at 100°C for 30 minutes to ensure complete killing of Coxiella burnetii

  • Personal Protective Equipment: Appropriate PPE includes laboratory coats, gloves, and eye protection. For work with live bacteria in BSL3, additional respiratory protection may be required.

  • Waste Management: All waste materials should be appropriately decontaminated before disposal, typically through autoclaving or chemical disinfection.

  • Post-Exposure Protocols: Institutions should have clear procedures for accidental exposures, including medical monitoring and prophylactic antibiotic treatment if necessary.

Researchers should also be aware that recently, scientists discovered that weakened forms of Coxiella burnetii used in research unexpectedly acquired increased virulence through genetic mutations . This highlights the importance of regular validation of attenuated strains.

How can researchers design experiments to differentiate the specific role of CBUD_0951 from other disulfide formation proteins?

Differentiating the specific roles of CBUD_0951 from other disulfide formation proteins requires carefully designed experimental approaches:

  • Gene Knockout and Complementation:

    • Create a CBUD_0951 deletion mutant in Coxiella burnetii

    • Complement the mutant with wild-type CBUD_0951

    • Compare phenotypes between wild-type, mutant, and complemented strains

    • Include controls with deletions of other disulfide formation proteins

  • Substrate Specificity Analysis:

    • Perform proteomic analysis to identify proteins whose folding depends on CBUD_0951

    • Compare this substrate profile with other disulfide formation proteins

    • Use pull-down assays to confirm direct interactions

  • Localization Studies:

    • Determine the subcellular localization of CBUD_0951 using immunogold electron microscopy

    • Compare with localization of other disulfide formation proteins

    • Correlate localization with potential substrates

  • Structure-Function Analysis:

    • Identify critical residues in the active site through site-directed mutagenesis

    • Compare the catalytic parameters (kcat/KM) with other disulfide formation proteins

    • Perform complementation experiments with chimeric proteins containing domains from different disulfide formation proteins

  • Temporal Expression Analysis:

    • Analyze expression patterns of CBUD_0951 during different growth phases and infection stages

    • Compare with expression patterns of other disulfide formation proteins

    • Correlate with phases where specific virulence factors are required

These approaches should be conducted in parallel to build a comprehensive understanding of CBUD_0951's unique contributions to bacterial physiology and pathogenesis.

How should researchers interpret contradictory findings in CBUD_0951 functional studies?

When facing contradictory findings in CBUD_0951 functional studies, researchers should implement a systematic analytical approach:

  • Experimental Condition Analysis:

    • Compare experimental conditions across studies (temperature, pH, redox environment)

    • Evaluate expression systems used (E. coli vs. other hosts)

    • Assess protein tags and their potential interference with function

    • Consider differences in bacterial strains used (laboratory-adapted vs. clinical isolates)

  • Methodological Validation:

    • Reproduce key experiments using standardized protocols

    • Implement positive and negative controls

    • Use multiple complementary techniques to confirm findings

  • Protein State Assessment:

    • Verify proper folding of the recombinant protein

    • Determine oligomerization state, as many disulfide formation proteins function as dimers

    • Assess post-translational modifications that might affect function

  • Biological Context Consideration:

    • Evaluate findings in the context of macrophage models vs. animal models

    • Consider the influence of host factors, particularly IL-10 levels which significantly affect Coxiella burnetii persistence

    • Analyze the bacterial growth phase when contradictory functions were observed

  • Integration with Systems Biology:

    • Place contradictory findings in the context of global protein interaction networks

    • Consider redundancy in disulfide formation systems

    • Evaluate genetic backgrounds and potential compensatory mechanisms

When reporting contradictory findings, researchers should clearly describe experimental conditions and propose testable hypotheses to resolve discrepancies rather than dismissing conflicting results.

What statistical approaches are most appropriate for analyzing CBUD_0951 expression data in different infection stages?

When analyzing CBUD_0951 expression data across different infection stages, researchers should employ robust statistical methods tailored to the experimental design:

  • For RT-qPCR Expression Data:

    • Normalization: Use multiple reference genes validated for stability during Coxiella infection

    • Statistical Tests: ANOVA with post-hoc tests for multiple time points; t-tests for two-condition comparisons

    • Multiple Testing Correction: Apply Benjamini-Hochberg procedure to control false discovery rate

    • Effect Size Reporting: Include fold-change alongside p-values

  • For RNA-Seq Analysis:

    • Normalization Methods: TPM (Transcripts Per Million) or TMM (Trimmed Mean of M-values)

    • Differential Expression: DESeq2 or EdgeR packages with appropriate dispersion estimation

    • Time-Course Analysis: Consider specialized tools like maSigPro or ImpulseDE2

    • Co-expression Network Analysis: WGCNA to identify genes with similar expression patterns

  • For Protein-Level Measurements:

    • Normalized Spectral Abundance Factors for mass spectrometry data

    • Mixed-effects models for repeated measures designs

    • Principal Component Analysis to identify major sources of variation

  • Data Visualization:

    • Heat maps for visualizing expression patterns across conditions

    • Volcano plots for highlighting significant changes

    • Trajectory plots for time-course data

  • Experimental Design Considerations:

    • Power analysis to ensure adequate biological replicates (minimum n=3, preferably n≥5)

    • Include time-matched controls for each condition

    • Consider batch effects and include appropriate blocking factors in the analysis

The statistical approach should be selected based on experimental design, data distribution, and specific research questions. Researchers should report both statistical significance and biological significance (effect size) when interpreting results.

What are the future research directions for understanding CBUD_0951's role in Coxiella burnetii pathogenesis?

Future research on CBUD_0951 should focus on integrating molecular mechanisms with in vivo pathogenesis to develop a comprehensive understanding of this protein's role in Coxiella burnetii infections. Several promising directions include:

  • Structural Biology Approaches:

    • Determine the three-dimensional structure of CBUD_0951 using X-ray crystallography or cryo-EM

    • Identify substrate binding sites and catalytic regions

    • Compare structural features with other bacterial disulfide formation proteins

  • Systems Biology Integration:

    • Map the complete "disulfidome" – all proteins dependent on CBUD_0951 for proper folding

    • Integrate this data with transcriptomics and proteomics during infection

    • Develop computational models of redox homeostasis in Coxiella burnetii

  • Host-Pathogen Interaction Studies:

    • Investigate how CBUD_0951-dependent proteins interact with host immune receptors

    • Determine if CBUD_0951 influences IL-10 production in host cells

    • Assess the protein's contribution to bacterial persistence in the IL-10 overexpression mouse model

  • Translational Applications:

    • Evaluate CBUD_0951 as a potential drug target for treating chronic Q fever

    • Assess the protein's utility as a diagnostic marker

    • Investigate potential vaccine applications, particularly using attenuated strains with modified CBUD_0951

  • Evolutionary Perspectives:

    • Compare CBUD_0951 across Coxiella isolates, including the recently discovered genetic variants with altered virulence

    • Analyze selective pressure on this gene to understand its importance for bacterial fitness

These research directions should be pursued with awareness of the biosafety considerations associated with Coxiella burnetii research, leveraging recently developed safer bacterial forms when appropriate .

How can findings from CBUD_0951 research contribute to therapeutic interventions for Q fever?

Research on CBUD_0951 has significant potential to inform therapeutic interventions for both acute and chronic Q fever through multiple pathways:

  • Target-Based Drug Development:

    • If CBUD_0951 proves essential for bacterial survival or virulence, it represents a potential antimicrobial target

    • High-throughput screening of compound libraries could identify specific inhibitors

    • Structure-based drug design could leverage the protein's three-dimensional structure

    • The unique aspects of bacterial disulfide formation compared to host systems offers selectivity

  • Diagnostic Applications:

    • CBUD_0951 or its substrate proteins could serve as biomarkers for active infection

    • Changes in anti-CBUD_0951 antibody titers might correlate with disease progression

    • Protein detection in clinical samples could improve diagnostic accuracy

  • Vaccine Development:

    • Attenuated Coxiella strains with modified CBUD_0951 activity could serve as live attenuated vaccines

    • Recombinant CBUD_0951, if immunogenic, could be included in subunit vaccine formulations

    • Understanding CBUD_0951's role in immune evasion could guide adjuvant selection

  • Immunomodulatory Approaches:

    • If CBUD_0951 contributes to IL-10 induction, targeting this pathway could prevent chronic infections

    • Combination therapies targeting both the bacteria and host immune response might be particularly effective for chronic Q fever

  • Prevention Strategies:

    • Improved understanding of environmental persistence mechanisms might inform disinfection protocols

    • Risk assessment tools could be developed based on bacterial strain characteristics

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.