Recombinant Coxiella burnetii Probable disulfide formation protein (CbuG_1114)

Shipped with Ice Packs
In Stock

Description

Functional Role in C. burnetii

CbuG_1114 is annotated as a probable disulfide formation protein, critical for:

  • Facilitating proper folding of bacterial secreted proteins through thiol-disulfide interchange

  • Stabilizing extracellular virulence factors via disulfide bond formation

  • Potential interaction with host proteasomes, as observed in other C. burnetii effector proteins

Diagnostic Development

  • ELISA Compatibility: Commercial kits utilize recombinant CbuG_1114 for antibody detection in Q fever serology .

  • Immunoreactivity Screening: In comparative studies, C. burnetii recombinant proteins showed sensitivities of 21–71% and specificities of 90–100% in immunoassays .

Production & Quality Control

ParameterSpecification
Reconstitution0.1–1.0 mg/mL in sterile water + 5–50% glycerol
StabilityStable for 1 week at 4°C; avoid freeze-thaw cycles
Analytical MethodsSDS-PAGE, mass spectrometry, circular dichroism

Limitations & Future Directions

  • Functional Validation: The AlphaFold model lacks experimental validation via X-ray crystallography or NMR .

  • Vaccine Potential: While pooled C. burnetii peptides induce Th1 immunity in mice, CbuG_1114-specific protective efficacy remains untested .

  • Host Interaction Mapping: No direct evidence yet links CbuG_1114 to host proteasome modulation, unlike other effectors (e.g., CirB) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchasing method and location. We recommend consulting your local distributors for specific delivery timelines.
Note: Our standard shipping includes blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges may apply.
Notes
Repeated freezing and thawing should be avoided. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend incorporating 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C. Our standard protocol includes 50% glycerol. You are welcome to adjust this concentration as needed.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Repeated freeze-thaw cycles should be minimized.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production process. If you have a specific tag type preference, please inform us, and we will prioritize developing it according to your request.
Synonyms
CbuG_1114; Probable disulfide formation protein; Disulfide oxidoreductase; Thiol-disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Coxiella burnetii (strain CbuG_Q212) (Coxiella burnetii (strain Q212))
Target Names
CbuG_1114
Target Protein Sequence
MMVSRLLKNYSLYFAWLTALIATLGSLYLSLVRHIPVCDLCWYQRVCIYPLTILLGIAAY RTDRGVVKYALPLVVLGFLFSVYQYLQQMIPGFAPINLCGSTSPHCSEIHWEIFGFITLP FLGMLATLIMSFFLIMAFYSLDKRLAN
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain proteins.
Database Links
Protein Families
DsbB family, BdbC subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is CbuG_1114 and what is its role in Coxiella burnetii pathogenesis?

CbuG_1114 is a 147-amino acid protein classified as a probable disulfide formation protein or disulfide oxidoreductase in Coxiella burnetii. It belongs to the family of thiol-disulfide oxidoreductases that catalyze the formation of disulfide bonds in extracytoplasmic proteins . While the specific role of CbuG_1114 in C. burnetii pathogenesis hasn't been fully characterized, related disulfide formation proteins in other intracellular pathogens, such as the DsbA2 protein in Legionella pneumophila, are known to be critical for the assembly of macromolecular structures including type IV secretion systems . C. burnetii, like other intracellular pathogens, evades host responses by secreting effector proteins through its Type 4B secretion system to establish a replication-friendly niche within host cells . Disulfide formation proteins likely play a crucial role in ensuring the proper folding and function of these secreted effectors and virulence factors.

How can I express and purify recombinant CbuG_1114 protein?

Recombinant CbuG_1114 can be successfully expressed in E. coli as a His-tagged fusion protein. The following protocol outlines the general methodology:

  • Clone the CbuG_1114 gene (nucleotides encoding amino acids 1-147) into an expression vector with an N-terminal His-tag .

  • Transform the plasmid into a suitable E. coli expression strain (BL21 or similar).

  • Induce protein expression with IPTG under optimized conditions.

  • Lyse cells and purify the protein using Ni-NTA affinity chromatography.

  • Perform additional purification steps if needed (size exclusion chromatography, ion exchange).

  • Concentrate the purified protein and store as a lyophilized powder or in a suitable buffer containing 50% glycerol at -20°C/-80°C to maintain stability .

The purified protein should have >90% purity as determined by SDS-PAGE. Avoid repeated freeze-thaw cycles as this may affect protein activity and stability .

How should I design experiments to characterize the disulfide oxidoreductase activity of CbuG_1114?

Characterizing the disulfide oxidoreductase activity of CbuG_1114 requires multiple complementary approaches:

In vitro enzymatic assays:

  • Insulin reduction assay: Monitor the reduction of insulin by measuring the increase in turbidity at 650 nm in the presence of DTT and CbuG_1114.

  • RNase A refolding assay: Measure the reactivation of reduced, denatured RNase A in the presence of CbuG_1114.

  • Thiol-disulfide exchange reactions: Use synthetic peptide substrates with specific disulfide bonds and monitor their reduction/oxidation.

Substrate identification:

  • Implement a proteomics approach similar to that used for DsbA2 in L. pneumophila. Generate a catalytically inactive CbuG_1114 mutant (e.g., by replacing a catalytic cysteine with alanine) .

  • Express this mutant in C. burnetii or a heterologous system to trap mixed disulfide complexes with substrate proteins.

  • Purify these complexes and identify trapped substrates via mass spectrometry.

Structural studies:

  • Determine the crystal structure of CbuG_1114 to confirm the presence of a thioredoxin-like fold and identify the active site.

  • Perform site-directed mutagenesis of predicted catalytic residues to confirm their importance for activity.

Comparative analysis:

  • Compare the oxidoreductase activity of CbuG_1114 with other bacterial DsbA proteins, including the DsbA2 protein from L. pneumophila .

  • Assess whether CbuG_1114 functions more efficiently with specific substrates, suggesting target specificity.

What are the optimal conditions for maintaining stability and activity of purified CbuG_1114?

Maintaining the stability and activity of purified CbuG_1114 requires careful attention to storage and handling conditions:

Storage conditions:

  • Store the protein at -20°C/-80°C as a lyophilized powder or in aliquots containing 50% glycerol to prevent ice crystal formation and protein denaturation .

  • Use Tris/PBS-based buffer at pH 8.0 with 6% trehalose as a cryoprotectant for long-term storage .

  • Avoid repeated freeze-thaw cycles which can lead to protein denaturation and loss of activity.

Working conditions:

  • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL concentration.

  • For routine experiments, working aliquots can be stored at 4°C for up to one week .

  • Maintain oxidizing conditions to preserve the catalytic cysteines in their active form.

  • Include stabilizers like glycerol (5-20%) in working solutions.

Activity preservation:

  • Monitor protein activity periodically using standard disulfide oxidoreductase assays.

  • Consider adding reducing agents (e.g., low concentrations of DTT or β-mercaptoethanol) to prevent non-specific oxidation of catalytic cysteines.

  • Avoid exposure to heavy metals and oxidizing agents that could interfere with the catalytic cysteines.

Quality control:

  • Use circular dichroism to verify protein folding after storage.

  • Perform SDS-PAGE under non-reducing and reducing conditions to confirm the presence of intact disulfide bonds.

How does CbuG_1114 compare with other bacterial disulfide formation proteins in structure and function?

Comparative analysis reveals both similarities and differences between CbuG_1114 and other bacterial disulfide formation proteins:

FeatureCbuG_1114 (C. burnetii)DsbA2 (L. pneumophila)Classical DsbA (E. coli)
Size147 amino acids ~27 kDa ~21 kDa
Catalytic motifCXXC (predicted)CXXCCPHC
Subcellular locationLikely periplasmicPeriplasmic Periplasmic
Functional roleDisulfide bond formationDisulfide bond formation in T4SS components General disulfide bond formation
Substrate specificityUnknown, likely specificComponents of Dot/Icm T4SS Broad range of substrates
Structural featuresLikely thioredoxin-like foldContains a cis-proline at position 198 Thioredoxin-like fold with insertions
Association with virulencePotential role in pathogenesisEssential for infectivity Contributes to virulence

The DsbA2 protein of L. pneumophila, which belongs to the Com1 lineage of DsbA-like proteins, has been shown to catalyze extracytoplasmic disulfide-bond formation in proteins including components of the Dot/Icm type IV secretion system . This function is essential for bacterial infectivity. Given the evolutionary relationship between L. pneumophila and C. burnetii and their shared reliance on type IV secretion systems for pathogenesis, CbuG_1114 likely plays a similar critical role in C. burnetii virulence by ensuring proper folding of secreted effectors and structural components of the T4BSS .

How can I use CbuG_1114 in immunization studies against C. burnetii infection?

Recombinant CbuG_1114 could be a valuable component in immunization studies against C. burnetii, given the precedent of using recombinant C. burnetii proteins in vaccine development . The following methodology outlines a research approach:

Immunogenicity assessment:

  • Express and purify CbuG_1114 as described earlier to >90% purity .

  • Formulate the protein with appropriate adjuvants (e.g., aluminum hydroxide, CpG oligonucleotides).

  • Immunize BALB/c mice with different doses (e.g., 10-50 μg) of adjuvanted CbuG_1114 protein using a prime-boost schedule.

  • Collect sera and assess antibody responses using ELISA and Western blot methods.

  • Characterize the isotype distribution of antibodies to evaluate the Th1/Th2 balance of the immune response.

Efficacy testing:

  • Challenge immunized mice with virulent C. burnetii (e.g., Nine Mile RSA493 strain) using intraperitoneal injection .

  • Monitor clinical signs, bacterial burden in tissues, and survival rates compared to control groups.

  • Include a positive control group vaccinated with a licensed Q fever vaccine (e.g., Q-Vax) for benchmarking .

  • Evaluate protection by quantifying bacterial loads in spleen and liver tissues using qPCR or immunohistochemistry.

Combination approaches:

  • Test CbuG_1114 in combination with other C. burnetii antigens. Previous studies have explored mixtures of recombinant proteins (e.g., Omp, HspB, Fbp) for improved protection .

  • Assess whether combining CbuG_1114 with other proteins involved in pathogenesis enhances protective immunity.

  • Consider heterologous prime-boost strategies using DNA vaccines encoding CbuG_1114 followed by protein boosting.

What are the challenges in studying structural-functional relationships of CbuG_1114, and how can they be addressed?

Studying structural-functional relationships of CbuG_1114 presents several technical challenges:

Challenge 1: Obtaining sufficient quantities of correctly folded protein

  • Solution: Optimize expression conditions using different E. coli strains (e.g., Origami, SHuffle) that enhance disulfide bond formation in the cytoplasm.

  • Consider coexpression with thioredoxin or disulfide isomerase to improve folding.

  • Explore periplasmic expression systems that naturally support disulfide bond formation.

Challenge 2: Crystallization for structural determination

  • Solution: Implement high-throughput crystallization screening with various buffer conditions.

  • Consider using truncated constructs that remove flexible regions while maintaining the catalytic core.

  • Explore fusion partners (e.g., T4 lysozyme) that may facilitate crystal formation.

  • Alternative approach: Use NMR spectroscopy for solution structure determination if crystallization proves difficult.

Challenge 3: Identifying physiological substrates

  • Solution: Develop a catalytically inactive trap mutant (similar to the P198T mutation in DsbA2 ) to capture and identify substrate proteins.

  • Perform crosslinking studies followed by mass spectrometry to identify interaction partners.

  • Use comparative proteomics to identify proteins with altered disulfide bonding in CbuG_1114-deficient C. burnetii (if genetic manipulation is possible).

Challenge 4: Establishing relevance to pathogenesis

  • Solution: Attempt generation of CbuG_1114 deletion mutants in C. burnetii to assess effects on viability and virulence.

  • If direct deletion is not viable (suggesting an essential function), use conditional expression systems.

  • Develop cell-based assays to assess the impact of CbuG_1114 inhibition on specific virulence mechanisms, such as T4BSS function or effector protein secretion.

How might CbuG_1114 interact with other C. burnetii proteins in the context of pathogenesis?

CbuG_1114 likely interacts with multiple C. burnetii proteins as part of its function in disulfide bond formation. Based on studies of related proteins, we can propose several interaction scenarios:

Interaction with secretion system components:
CbuG_1114 may catalyze disulfide bond formation in components of the Type 4B secretion system (T4BSS), which C. burnetii uses to secrete effector proteins approximately 4-8 hours after infection . Similar to DsbA2 in L. pneumophila, which interacts with Dot/Icm T4SS components , CbuG_1114 may ensure proper folding and assembly of the C. burnetii T4BSS complex. This would make CbuG_1114 indirectly essential for the delivery of all T4BSS-dependent effectors.

Interaction with secreted effector proteins:
C. burnetii genome analysis predicts approximately 140 effector proteins , many of which are likely to contain disulfide bonds essential for their stability and function. CbuG_1114 may directly interact with these effectors during their translocation across the bacterial membrane, catalyzing the formation of critical disulfide bonds before their secretion into the host cell.

Potential interaction with Fic proteins:
C. burnetii encodes five conserved Fic (filamentation induced by cAMP) proteins, three of which (CBU_0372, CBU_0822, and CBU_2078) are predicted to be secreted effectors . The Fic2 enzyme (product of CBU_0822) has been shown to AMPylate and deAMPylate host histone H3, switching between these activities upon DNA binding . CbuG_1114 might catalyze disulfide bond formation in these Fic proteins, thereby regulating their activity.

Research approaches to study these interactions:

  • Co-immunoprecipitation studies using tagged CbuG_1114.

  • Bacterial two-hybrid screening to identify interaction partners.

  • Mass spectrometry analysis of proteins that co-purify with a substrate-trapping mutant of CbuG_1114.

  • Comparative proteomic analysis of disulfide-containing proteins in wild-type versus CbuG_1114-depleted C. burnetii.

  • Structural studies of CbuG_1114 in complex with candidate substrate proteins.

What are common issues in the expression and purification of CbuG_1114, and how can they be resolved?

Researchers frequently encounter several technical challenges when working with recombinant CbuG_1114:

Problem 1: Low expression yield

  • Potential causes: Toxicity to E. coli, improper codon usage, protein instability

  • Solutions:

    • Use lower induction temperatures (16-20°C) and longer induction times

    • Consider codon optimization for E. coli expression

    • Test different E. coli strains (BL21, Rosetta, Arctic Express)

    • Use tightly controlled inducible promoters to minimize leaky expression

    • Co-express with molecular chaperones to improve folding

Problem 2: Inclusion body formation

  • Potential causes: Rapid overexpression, improper folding, disulfide bond issues

  • Solutions:

    • Reduce induction temperature and IPTG concentration

    • Use specialized E. coli strains for disulfide bond formation (Origami, SHuffle)

    • Consider periplasmic expression strategies

    • If inclusion bodies persist, develop a refolding protocol using gradual dialysis from denaturing conditions

Problem 3: Poor protein solubility

  • Potential causes: Hydrophobic regions, improper folding, aggregation

  • Solutions:

    • Add solubility-enhancing tags (SUMO, MBP, TrxA) instead of just a His-tag

    • Include mild detergents in lysis and purification buffers

    • Optimize buffer conditions (pH, salt concentration, additives)

    • Consider using arginine or proline as stabilizing agents in buffers

Problem 4: Low purity after affinity purification

  • Potential causes: Non-specific binding to resin, protein degradation

  • Solutions:

    • Increase imidazole concentration in wash buffers

    • Add secondary purification steps (ion exchange, size exclusion)

    • Include protease inhibitors during purification

    • Work at lower temperatures to minimize degradation

    • Consider on-column refolding protocols if dealing with solubilized inclusion bodies

How can I analyze the enzymatic activity of CbuG_1114 in cell-free and cellular systems?

A comprehensive analysis of CbuG_1114 enzymatic activity requires both cell-free biochemical assays and cellular systems:

Cell-free enzymatic assays:

  • Standard oxidoreductase activity assays:

    • Insulin turbidity assay: Monitor the precipitation of insulin B chain upon reduction of the disulfide bonds

    • DTT oxidation assay: Measure the rate of DTT oxidation spectrophotometrically at 310 nm

    • Synthetic peptide substrates: Use fluorescence-quenched peptides containing disulfide bonds

  • Enzyme kinetics analysis:

    • Determine Km, Vmax, and kcat using increasing concentrations of model substrates

    • Analyze the pH and temperature dependence of activity

    • Assess the impact of redox potential on enzymatic activity

  • Substrate specificity profiling:

    • Screen peptide libraries with varying amino acid sequences around cysteine residues

    • Compare activity on model substrates from different bacterial secretion systems

    • Assess activity on denatured proteins containing disulfide bonds

Cellular systems:

  • Complementation studies in bacterial models:

    • Express CbuG_1114 in E. coli dsbA mutants and assess restoration of phenotypes

    • Test functional complementation of L. pneumophila dsbA2 mutants

    • If possible, develop a conditional CbuG_1114 mutant in C. burnetii

  • Substrate identification in cellular context:

    • Express tagged CbuG_1114 in C. burnetii or surrogate hosts

    • Use proximity labeling (BioID or APEX) to identify proteins in close proximity

    • Perform redox proteomics to identify proteins with altered disulfide status

  • Visualization techniques:

    • Use fluorescent protein fusions to track CbuG_1114 localization

    • Implement split GFP complementation assays to visualize protein-protein interactions

    • Apply redox-sensitive fluorescent probes to monitor disulfide formation

What are the considerations for designing inhibitors or modulators of CbuG_1114 activity for research purposes?

Designing effective inhibitors or modulators of CbuG_1114 requires a structured approach:

Target site identification:

  • The active site containing the CXXC motif is the primary target for inhibition

  • Allosteric sites that may affect conformational changes during catalysis

  • Protein-protein interaction surfaces that mediate substrate recognition

Chemical strategies for inhibitor design:

  • Covalent inhibitors that react with the catalytic cysteines (e.g., alkylating agents, electrophilic compounds)

  • Competitive inhibitors that mimic substrate binding but resist catalysis

  • Redox-active compounds that interfere with the redox cycling of the enzyme

  • Peptide-based inhibitors derived from substrate recognition sequences

Screening methodologies:

  • Structure-based virtual screening if crystal structure is available

  • Fragment-based screening to identify initial chemical scaffolds

  • High-throughput biochemical assays using the oxidoreductase activity assays

  • Differential scanning fluorimetry to identify compounds that alter protein stability

Validation approaches:

  • Confirm direct binding using biophysical methods (ITC, SPR, NMR)

  • Verify the inhibition mechanism through enzyme kinetics

  • Determine X-ray crystal structures of CbuG_1114-inhibitor complexes

  • Test cellular activity in bacterial culture systems

  • Evaluate effect on C. burnetii intracellular growth and T4BSS function

Important considerations:

  • Selectivity against human PDI and other oxidoreductases to minimize off-target effects

  • Membrane permeability to reach the presumed periplasmic location of CbuG_1114

  • Stability in the oxidizing environment of the periplasm

  • Potential for development of resistance through mutations

How might comparative genomics inform our understanding of CbuG_1114 evolution and function?

Comparative genomics approaches can provide valuable insights into the evolution and function of CbuG_1114:

Evolutionary analysis:

  • Perform phylogenetic analysis of CbuG_1114 and related disulfide formation proteins across bacterial species

  • Analyze selective pressure on CbuG_1114 using dN/dS ratios to identify conserved functional domains

  • Compare CbuG_1114 with the Com1-like proteins in related intracellular pathogens such as Legionella

  • Examine horizontal gene transfer events that may have contributed to the acquisition of disulfide formation systems

Functional prediction through conservation:

  • Identify absolutely conserved residues beyond the catalytic CXXC motif that may have functional importance

  • Map conservation patterns onto structural models to identify potential substrate binding regions

  • Compare conservation patterns between obligate intracellular pathogens and free-living bacteria

  • Analyze co-evolution between CbuG_1114 and potential substrate proteins, particularly those involved in the T4BSS

Genomic context analysis:

  • Examine the genomic neighborhood of CbuG_1114 for functionally related genes

  • Look for conserved operonic structures across Coxiella species and strains

  • Identify regulatory elements in the promoter region that may suggest condition-specific expression

  • Compare the presence/absence of CbuG_1114 homologs with specific virulence traits across bacterial species

Experimental validation strategies:

  • Generate chimeric proteins between CbuG_1114 and other disulfide formation proteins to identify functional domains

  • Perform site-directed mutagenesis of conserved residues identified through comparative analysis

  • Express CbuG_1114 homologs from different bacterial species and compare their substrate specificity

What role might CbuG_1114 play in the context of C. burnetii's unique intracellular lifestyle?

CbuG_1114, as a disulfide formation protein, likely plays specialized roles in supporting C. burnetii's adaptation to its unique intracellular lifestyle:

Adaptation to the acidic phagolysosome:
C. burnetii uniquely thrives in acidic phagolysosomal compartments. CbuG_1114 may have evolved specific features to maintain activity under these acidic conditions, ensuring proper folding of proteins essential for acid resistance. The protein's role in disulfide bond formation could be critical for maintaining the structural integrity of membrane proteins and secreted effectors that function in this harsh environment.

Support for T4BSS-dependent effector secretion:
Similar to DsbA2 in L. pneumophila , CbuG_1114 likely ensures proper folding and assembly of the T4BSS apparatus that C. burnetii uses to secrete approximately 140 effector proteins into host cells . These effectors manipulate various host processes including apoptosis, transcriptional regulation, proteasomal degradation, and maintenance of the Coxiella-containing vacuole .

Redox homeostasis during infection cycles:
C. burnetii undergoes a biphasic developmental cycle with metabolically active large cell variants (LCVs) and dormant small cell variants (SCVs). CbuG_1114 might play differential roles during these phases, particularly in the transition to the highly resistant SCV form where proper protein folding and disulfide bonding would be crucial for long-term stability.

Potential role in antigenic variation:
Disulfide bonds are often critical for the proper folding and presentation of surface antigens. CbuG_1114 may influence the folding of surface proteins involved in antigenic variation or immune evasion, thereby contributing to C. burnetii's ability to establish persistent infections.

Experimental approaches to investigate these roles:

  • Develop inducible knockdown systems for CbuG_1114 to analyze effects on different stages of the C. burnetii lifecycle

  • Perform comparative proteomics on wild-type versus CbuG_1114-depleted bacteria to identify proteins dependent on its activity

  • Analyze the timing of CbuG_1114 expression during the developmental cycle using transcriptomics and reporter fusions

  • Test the activity of CbuG_1114 under conditions mimicking the phagolysosomal environment

How can systems biology approaches enhance our understanding of CbuG_1114 in the context of C. burnetii pathogenesis?

Systems biology approaches can provide a holistic understanding of CbuG_1114's role in C. burnetii pathogenesis:

Multi-omics integration:

  • Combine transcriptomics, proteomics, and metabolomics data to place CbuG_1114 within regulatory networks

  • Analyze co-expression patterns to identify genes functionally related to CbuG_1114

  • Use phosphoproteomics and other PTM-focused approaches to identify signaling pathways connected to CbuG_1114 function

  • Apply network analysis to predict functional interactions based on guilt-by-association principles

Temporal dynamics analysis:

  • Perform time-course experiments during infection to track changes in CbuG_1114 expression and activity

  • Correlate these changes with broader shifts in bacterial and host cell biology

  • Identify key transition points where CbuG_1114 activity may be particularly critical

  • Develop mathematical models of the infection process incorporating CbuG_1114 function

Host-pathogen interaction mapping:

  • Use dual RNA-seq to simultaneously track bacterial and host transcriptional responses

  • Apply proximity labeling methods to identify host proteins that interact with CbuG_1114 substrates

  • Develop fluorescent reporters to visualize CbuG_1114 activity during infection

  • Use genome-wide CRISPR screens to identify host factors that modulate dependence on CbuG_1114

Predictive modeling applications:

Integration with clinical data:

  • Correlate variations in CbuG_1114 sequence across clinical isolates with virulence or persistence phenotypes

  • Analyze antibody responses to CbuG_1114 during natural infections

  • Assess whether CbuG_1114 inhibition could synergize with existing antibiotics

  • Explore correlations between CbuG_1114 sequence variants and clinical outcomes in Q fever cases

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.