Recombinant Coxiella burnetii Probable disulfide formation protein (CbuK_0753)

Shipped with Ice Packs
In Stock

Description

Functional Role in Coxiella burnetii

CbuK_0753 belongs to the Dsb (disulfide bond) protein family, which catalyzes the formation and isomerization of disulfide bonds in periplasmic or secreted proteins. Key insights include:

  • Mechanism: Acts as a thiol-disulfide oxidoreductase, enabling proper folding of virulence factors and outer membrane proteins .

  • Pathogen Survival: Essential for C. burnetii’s intracellular survival, as disulfide bonds stabilize proteins critical for host cell invasion and immune evasion .

Comparative Analysis of C. burnetii Disulfide Formation Proteins:

Gene NameProtein NameHost SystemFunction
CbuK_0753Probable disulfide formation proteinE. coli/MammalianOxidative folding, redox regulation
CBU_0888DsbB family proteinCell-free expressionDisulfide bond isomerization
bdbCDisulfide bond formation protein BE. coli/YeastRedox homeostasis

Diagnostic Development

  • Antigen Screening: Recombinant CbuK_0753 has been evaluated for immunoreactivity in Q fever diagnostics. While not yet a primary antigen, related proteins (e.g., CBU_1718) show sensitivities up to 71% in ELISA-based assays .

  • Multiplex Assays: Explored in combination with other antigens to improve sensitivity, though truncations reduce efficacy .

Therapeutic Targets

  • Antibiotic Resistance: Studies on C. burnetii’s redox systems highlight CbuK_0753 as a potential target, given its role in maintaining bacterial fitness under oxidative stress .

  • Vaccine Design: Proteins involved in disulfide bond formation are under investigation for subunit vaccines, leveraging their surface exposure and immunogenicity .

Challenges and Future Directions

  • Functional Redundancy: C. burnetii encodes multiple disulfide bond proteins (e.g., CBU_0888, bdbC), complicating targeted inhibition .

  • Animal Models: Limited data on CbuK_0753’s role in vivo; current insights derive from in vitro macrophage infection models .

Key Research Findings

  • Immunogenicity: While CbuK_0753 is not among the top antigens in human seroreactivity screens (e.g., CBU_1718 shows higher diagnostic potential), it remains a candidate for strain-specific studies .

  • Genomic Stability: MLVA genotyping of C. burnetii outbreaks reveals low diversity in disulfide-related genes, suggesting conserved roles across strains .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order. We will prepare the product according to your preference.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for the specific delivery timeframe.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
CbuK_0753; Probable disulfide formation protein; Disulfide oxidoreductase; Thiol-disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Coxiella burnetii (strain CbuK_Q154) (Coxiella burnetii (strain Q154))
Target Names
CbuK_0753
Target Protein Sequence
MMVFRLLKNYSLYFAWLTALIATLGSLYLSLVRHIPVCDLCWYQRVCIYPLTILLGIAAY RTDRGVVKYALPLVVLGFLFSIYQYLQQMIPGFAPINLCGSTSPHCSEIHWEIFGFITLP FLGMLATLIMSFFLIMAFYSLDKRLAN
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain proteins.
Database Links
Protein Families
DsbB family, BdbC subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological significance of disulfide formation proteins in Coxiella burnetii?

Disulfide formation proteins in Coxiella burnetii play crucial roles in protein folding and stability within this intracellular pathogen. These proteins catalyze the formation of disulfide bonds, which are critical for maintaining the tertiary structure of many bacterial proteins, especially those involved in virulence and survival within the host cell. In C. burnetii, proper disulfide bond formation is particularly important as the bacterium must adapt to the harsh acidic environment of the phagolysosome where it replicates .

Research indicates that disulfide formation pathways contribute to the pathogen's ability to establish a replication-permissive niche within host cells. The process involves oxidation of cysteine residues in newly synthesized proteins, creating structural stability through covalent bonds. Unlike simpler redox systems, C. burnetii has evolved sophisticated disulfide formation machinery that functions in the oxidative environment it encounters during infection .

How does CbuK_0753 compare to other disulfide formation proteins in the Coxiella genome?

While the search results don't specifically address CbuK_0753, comparative genomic analysis of C. burnetii strains reveals considerable variation in protein profiles across different isolates. Pangenomic analysis shows that C. burnetii has an open pangenome with 1,211 core genes and 4,501 genes in the total pangenome (ratio 0.27), indicating substantial genomic plasticity .

The functional role of CbuK_0753 should be examined in context with other disulfide formation proteins identified in C. burnetii. Research methodologies would include:

  • Sequence alignment with homologous proteins in related bacteria

  • Domain structure analysis to identify catalytic sites

  • Expression pattern analysis across different growth conditions

  • Knockout studies to determine essentiality

Experimental approaches should incorporate both bioinformatic prediction and laboratory validation to establish the specific catalytic mechanisms that distinguish CbuK_0753 from other disulfide formation proteins in the Coxiella genome.

What are the optimal expression systems for producing recombinant CbuK_0753?

The optimal expression system for recombinant CbuK_0753 should consider several factors specific to disulfide-forming proteins:

Expression Systems Comparison:

Expression SystemAdvantagesLimitationsRecommended Conditions
E. coli BL21(DE3)High yield, economicalMay form inclusion bodiesLow temperature (16-20°C), 0.1-0.5 mM IPTG induction
E. coli OrigamiEnhanced disulfide formationLower yieldExtended expression time (16-24h)
BaculovirusProper folding, post-translational modificationsHigher cost, longer production timeMOI 1-5, harvest 72h post-infection
Cell-free systemsRapid production, avoids toxicityScale limitationsSupplementation with GSH/GSSG redox pairs

The choice of expression system should be guided by the specific research objectives. For structural studies requiring large protein quantities, E. coli systems with optimization for disulfide formation may be sufficient. For functional studies, insect cell or mammalian expression systems that better recapitulate the protein's native folding environment may be preferable .

Regardless of the expression system, co-expression with chaperones or disulfide isomerases can significantly improve the yield of correctly folded protein. Purification should incorporate steps that maintain the protein's redox state to preserve native disulfide bonds .

What techniques are most effective for analyzing disulfide bond formation in CbuK_0753?

Analyzing disulfide bond formation in CbuK_0753 requires a multi-faceted approach to capture both the formation process and the final structural arrangement:

Mass Spectrometry-Based Approaches:

  • Liquid chromatography coupled with tandem mass spectrometry (LC-MS/MS) with peptide mapping can identify cysteine residues involved in disulfide bonding

  • Differential alkylation of free vs. bonded cysteines before MS analysis provides quantitative assessment of disulfide formation efficiency

Biophysical Techniques:

  • Circular dichroism (CD) spectroscopy to monitor secondary structure changes accompanying disulfide formation

  • Fluorescence spectroscopy to track conformational changes during folding and oxidation

  • Isothermal titration calorimetry to measure thermodynamic parameters of folding coupled to disulfide formation

Real-time Analysis:

  • Force spectroscopy techniques similar to those described in the literature allow direct observation of disulfide formation during protein folding

  • These approaches can distinguish between native and non-native disulfide formation, crucial for understanding the folding pathway

Research has demonstrated that non-native disulfides typically form early in the folding pathway and can trigger misfolding, while native disulfides are often formed at later stages of folding. This temporal separation is critical for understanding the function of disulfide formation proteins like CbuK_0753 .

How does genomic diversity of C. burnetii affect the structure and function of disulfide formation proteins like CbuK_0753?

The genomic diversity of C. burnetii has significant implications for understanding disulfide formation proteins. Pangenomic analysis of 75 C. burnetii strains revealed high genomic plasticity, with an open pangenome containing significantly more genes (4,501) than the core genome (1,211) .

This diversity manifests in several ways relevant to disulfide formation proteins:

  • Strain-specific variations: Different C. burnetii isolates show variations in gene content and COG (Clusters of Orthologous Groups) profiles that could affect disulfide formation pathways

  • Plasmid-associated features: The presence of different plasmid types (QpH1, QpRS, QpDV) correlates with different clinical manifestations, suggesting variations in virulence factors that may include disulfide-dependent proteins

  • Mobile genetic elements: C. burnetii possesses numerous IS sequences that contribute to genomic plasticity, potentially affecting the evolution of protein folding machinery

The functional implications of this diversity should be investigated through comparative genomics and experimental validation. Researchers should consider:

  • Analyzing conservation patterns of CbuK_0753 across different C. burnetii isolates

  • Examining whether strain-specific variations correlate with differences in pathogenicity

  • Investigating whether genomic plasticity has led to functional adaptations in disulfide formation pathways

This research area remains underexplored but offers significant potential for understanding how genomic diversity influences protein structure and function in this important pathogen .

What is the mechanism of interaction between CbuK_0753 and other components of the C. burnetii protein folding machinery?

The mechanism of interaction between disulfide formation proteins and other components of protein folding machinery in C. burnetii likely follows patterns observed in other bacterial systems, with important pathogen-specific adaptations:

Proposed Interaction Mechanism:

  • Initial substrate recognition: Disulfide formation proteins likely recognize exposed cysteine residues or specific structural motifs in unfolded or partially folded substrate proteins

  • Mixed disulfide intermediate formation: Similar to PDI-mediated reactions, formation of a mixed disulfide complex between the enzyme and substrate is a critical intermediate step

  • Conformational changes: Substrate folding progresses while the disulfide formation protein remains attached as a "placeholder"

  • Resolution phase: As the substrate approaches its native conformation, the mixed disulfide is resolved to form an intramolecular disulfide in the substrate, releasing the disulfide formation protein

This mechanism requires coordination with other folding machinery components, including chaperones that prevent aggregation during the folding process. The acidic environment of the Coxiella-containing vacuole likely influences these interactions, as protein folding dynamics are affected by pH .

Advanced research should explore these interactions using techniques such as:

  • Crosslinking mass spectrometry to capture transient interactions

  • Hydrogen-deuterium exchange to map conformational changes

  • FRET-based approaches to monitor real-time interactions in cellular contexts

Understanding these interactions is crucial for developing a comprehensive model of protein folding in this intracellular pathogen .

What are the critical active site residues in CbuK_0753 and how do they compare to homologous proteins?

While specific information about CbuK_0753's active site is not directly addressed in the search results, we can draw insights from research on disulfide formation proteins in general. Critical active site features typically include:

  • Catalytic cysteine residues: Usually arranged in a CXXC motif, with the N-terminal cysteine initiating nucleophilic attack on substrate disulfides

  • Stabilizing residues: Often include histidine or arginine residues that modulate the reactivity of catalytic cysteines

  • Substrate binding pocket: Hydrophobic or charged residues that position substrate cysteines appropriately for reaction

Researchers should approach the characterization of CbuK_0753's active site through:

  • Site-directed mutagenesis of predicted catalytic residues followed by activity assays

  • Structural determination through X-ray crystallography or cryo-EM

  • Molecular dynamics simulations to understand the catalytic mechanism

  • Redox potential measurements of the active site cysteines to determine reaction preferences

Comparison with homologous proteins, particularly those from other intracellular bacteria, can provide insights into functional conservation and specialization. Special attention should be given to adaptations that might enable function in the acidic environment where C. burnetii replicates .

How does the redox environment of the Coxiella-containing vacuole affect the function of CbuK_0753?

The Coxiella-containing vacuole (CCV) presents a unique redox environment that likely influences the function of disulfide formation proteins. C. burnetii has adapted to replicate in this acidic (pH ~4.5) compartment, which has implications for protein stability and function .

Redox Considerations for CbuK_0753 Function:

AspectImpact on FunctionExperimental Approaches
Acidic pHMay alter redox potential of catalytic cysteinesActivity assays across pH range 4.0-7.5
Oxidative stressCould affect equilibrium between reduced/oxidized statesROS sensitivity assays, glutathione buffer experiments
CompartmentalizationSpatial regulation of redox environmentsFluorescence microscopy with redox-sensitive probes
Temporal dynamicsChanges in redox status during infection cycleTime-course experiments measuring protein activity

Research has shown that bacterial effector proteins released into the host cell cytosol via the Type 4B secretion system (T4BSS) approximately 4 to 8 hours after infection play critical roles in manipulating host processes . If CbuK_0753 functions as a secreted effector, its activity would need to be regulated to prevent premature activation before reaching its target.

Advanced studies should investigate how redox regulation coordinates with other aspects of C. burnetii pathogenesis, particularly in the context of establishing and maintaining the replicative niche .

What role might CbuK_0753 play in C. burnetii virulence and potential as a therapeutic target?

Disulfide formation proteins like CbuK_0753 may be significant contributors to C. burnetii virulence through several mechanisms:

  • Structural stability of virulence factors: Many bacterial virulence factors require disulfide bonds for stability and function, especially those secreted into the host environment

  • Adaptation to intracellular life: Proper protein folding is critical for bacterial adaptation to the harsh conditions of the phagolysosome

  • Host-pathogen interactions: Similar to the Fic2 enzyme (CBU_0822) that modifies host histones, disulfide formation proteins might participate in modulating host cell functions

The potential of CbuK_0753 as a therapeutic target depends on several factors:

Target Assessment Criteria:

CriterionConsiderationsResearch Needs
EssentialityIs the protein essential for bacterial survival?Conditional knockout studies
DruggabilityDoes the protein have suitable binding pockets?Structural analysis, in silico screening
SelectivityIs the bacterial protein sufficiently different from host homologs?Comparative structural analysis
Resistance potentialHow likely is resistance development?Evolution experiments, structural flexibility assessment

Research has shown that C. burnetii strains can be associated with different clinical presentations. For example, MST1 genotype strains were associated with acute Q fever, while strains harboring the QpRS plasmid were associated with persistent focalized infections . Understanding how disulfide formation proteins contribute to these differences could inform targeted therapeutic approaches.

How can high-throughput approaches be applied to study the substrate specificity of CbuK_0753?

High-throughput approaches can significantly accelerate the characterization of CbuK_0753's substrate specificity, providing insights into its biological function:

Proteomic Approaches:

  • Redox proteomics using isoTOP-ABPP (isotopic tandem orthogonal proteolysis-activity-based protein profiling) to identify proteins with modified cysteine residues

  • SILAC (stable isotope labeling with amino acids in cell culture) combined with enrichment of disulfide-containing peptides to compare proteomes with and without functional CbuK_0753

Library Screening Methods:

  • Phage display of peptide libraries to identify preferred binding motifs

  • Fluorescence-based assays using peptide arrays with varying cysteine-containing sequences

Computational Strategies:

  • Machine learning approaches to predict potential substrates based on sequence and structural features

  • Molecular docking simulations to assess binding affinity with candidate substrates

Validation Pipeline:

  • Initial high-throughput identification of candidate substrates

  • Secondary screening using in vitro disulfide formation assays

  • Cellular validation using proximity labeling approaches

  • Functional validation through phenotypic assessment of substrate modification

These approaches should be integrated with existing knowledge about C. burnetii proteins, particularly those involved in virulence and adaptation to intracellular life. The bifunctional nature observed in other C. burnetii enzymes (like the Fic2 enzyme that can both AMPylate and deAMPylate depending on its oligomeric state) suggests that CbuK_0753 might also have context-dependent activities that should be considered in experimental design .

What are the major challenges in expressing and purifying active recombinant CbuK_0753?

Expressing and purifying active recombinant disulfide formation proteins presents several technical challenges:

Major Challenges and Solutions:

ChallengeUnderlying IssueSolution Strategies
Maintaining redox stateCatalytic cysteines may oxidize inappropriatelyInclude reducing agents during purification; use anaerobic purification techniques
Solubility issuesImproper disulfide formation can lead to aggregationCo-expression with chaperones; use solubility tags (MBP, SUMO); optimize buffer conditions
Conformational heterogeneityMultiple redox states can create sample heterogeneitySEC-MALS analysis to assess oligomeric state; protein engineering to stabilize desired conformation
Activity preservationActivity can be lost during purificationRapid purification protocols; activity assays at each purification stage
Endotoxin contaminationExpression in bacterial systems can introduce endotoxinsEndotoxin removal steps; expression in eukaryotic systems

Research on protein disulfide isomerase (PDI) has demonstrated that disulfide formation enzymes can exist in multiple conformational states related to their catalytic cycle . This conformational flexibility, while essential for function, can complicate structural and biochemical studies. Researchers should implement quality control measures to assess protein homogeneity, including analytical ultracentrifugation and native PAGE.

How can researchers differentiate between native and non-native disulfide formation catalyzed by CbuK_0753?

Differentiating between native and non-native disulfide formation is critical for understanding the biological function of CbuK_0753. Research has shown that non-native disulfides often form early in protein folding pathways and can lead to misfolding, while native disulfides typically form later in the folding process .

Methodological Approaches:

  • Temporal analysis: Techniques that enable time-resolved sampling during folding can capture the sequence of disulfide formation events

    • Pulse-chase experiments with acid quenching

    • Stopped-flow mixing coupled with rapid spectroscopic detection

    • Single-molecule force spectroscopy as described in the literature

  • Structural discrimination: Methods that distinguish correctly folded from misfolded states

    • Proteolytic susceptibility assays (correctly folded proteins often resist proteolysis)

    • Conformation-specific antibodies that recognize only the native state

    • Functional assays for substrate proteins that require correct disulfide formation

  • Disulfide mapping: Techniques to identify specific disulfide pairs

    • Mass spectrometry with non-reducing/reducing comparisons

    • Diagonal electrophoresis

    • Selective labeling of free vs. bonded cysteines

The research on PDI has demonstrated that a mixed disulfide complex is formed between the enzyme and substrate, and the enzyme acts as a "placeholder" allowing the substrate to collapse and fold. Only at a late stage of folding does the enzyme catalyze the formation of the intramolecular disulfide in the substrate . Similar mechanisms might apply to CbuK_0753, and researchers should design experiments to test this model.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.