Recombinant Coxiella burnetii Uncharacterized protein CBU_1413 (CBU_1413)

What is the primary structure of CBU_1413 protein?

CBU_1413 is a full-length protein from Coxiella burnetii with 231 amino acids (mature protein spans residues 29-259). The amino acid sequence is: GGPEIPPSAPWVIYLGGFGGIYVANFEYQGTYLGGSFTVPIGSNVHQNGYTAGGHIGLRYYFSNPWFLGLEFAAMGNSENATTAESVLAPSPDDLIFNLVNQFRIKSNLDLTAQLGVNITPQTRVYIKGGASYARIRHILTVFNPATLTPTISLQRTTHKNRWGFLVGFGLGYDFCPWFGIFTEYNYYDYGRVGLDSLSNIRPNNGADTYHQNVRVHAYSVLLGVNLNFSV .

For research applications, the recombinant form typically includes an N-terminal His-tag to facilitate purification and detection in experimental settings. When expressing this protein recombinantly, researchers should consider the mature protein boundaries (29-259) rather than the full sequence including signal peptides, as this represents the functional form of the protein .

What is known about the conserved domains in CBU_1413?

In-silico analysis has revealed that CBU_1413 contains a conserved Mth938-like domain. This domain has been implicated in preadipocyte differentiation and adipogenesis processes, suggesting a potential metabolic role for this protein. The domain conservation indicates evolutionary preservation of function, which may be critical for the pathogen's survival or interaction with host cellular machinery .

Researchers investigating domain functionality should employ comparative structural analysis with other proteins containing Mth938-like domains and consider:

• Sequence alignments to identify conserved motifs

• Secondary structure prediction to understand folding patterns

• Tertiary structure modeling to reveal functional sites

The presence of this specific domain provides initial direction for hypothesis formation regarding protein function, particularly in the context of host-pathogen interactions related to lipid metabolism .

What are the physicochemical properties and stability considerations for working with recombinant CBU_1413?

Recombinant CBU_1413 is typically provided as a lyophilized powder with purity greater than 90% as determined by SDS-PAGE. For optimal research applications, consider the following properties and handling guidelines:

Stability and Storage:

• Store lyophilized protein at -20°C/-80°C upon receipt

• Aliquoting is necessary for multiple uses to prevent degradation from freeze-thaw cycles

• After reconstitution, working aliquots can be stored at 4°C for up to one week

Reconstitution Guidelines:

• Briefly centrifuge the vial before opening

• Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add 5-50% glycerol (final concentration) for long-term storage

• Standard practice uses 50% glycerol final concentration

Storage Buffer Composition:

• Tris/PBS-based buffer

• 6% Trehalose

• pH 8.0

These specifications are critical for maintaining protein integrity during experimental procedures. Researchers should carefully monitor storage conditions as improper handling can lead to protein degradation, aggregation, or loss of functional properties, potentially compromising experimental results.

What bioinformatics approaches can be used to predict the function of CBU_1413?

Comprehensive in silico analysis represents a valuable first step in characterizing uncharacterized proteins like CBU_1413. The following methodological approaches have proven effective:

Sequence-Based Analysis:

• Homology searches using BLAST against protein databases

• Multiple sequence alignment with potential orthologs

• Motif identification using tools like PROSITE, PFAM

• Evolutionary analysis to identify conserved regions

Structural Prediction and Analysis:

• Secondary structure prediction using tools like PSIPRED

• Tertiary structure modeling using methods like I-TASSER or AlphaFold2

• Analysis of predicted binding pockets and active sites

• Molecular docking studies with potential ligands

Functional Annotation:

• Gene Ontology (GO) term prediction

• Protein-protein interaction network analysis

• Pathway mapping and enrichment analysis

• Integration of transcriptomic data when available

In the specific case of CBU_1413, these approaches revealed its conserved Mth938-like domain and suggested its potential role in adipogenesis. The subcellular localization was predicted to be cytoplasmic, indicating involvement in intracellular processes rather than membrane-associated or secreted functions .

How can the role of CBU_1413 in C. burnetii pathogenesis be experimentally validated?

To experimentally validate the role of CBU_1413 in C. burnetii pathogenesis, researchers should implement a multi-faceted approach:

Genetic Manipulation Strategies:

• Gene knockout or knockdown studies to observe phenotypic changes

• Complementation experiments to confirm observed phenotypes

• Site-directed mutagenesis of predicted functional residues

• Conditional expression systems to study temporal requirements

Host-Pathogen Interaction Studies:

• Protein-protein interaction studies using pull-down assays or yeast two-hybrid screens

• Co-localization experiments using fluorescently tagged proteins

• Infection models with wild-type versus mutant strains

• Transcriptomic analysis of host response to wild-type versus mutant strains

Functional Assays:

• Adipogenesis assays to test the predicted role in fat metabolism

• Cell survival and proliferation assays in the presence/absence of the protein

• Immune response measurements including cytokine expression profiles

• Lipid metabolism analysis in infected cells

Animal Model Experiments:

• Challenge studies with wild-type versus knockout strains

• Histopathological analysis of infected tissues

• Immunological profiling of host response

• Vaccine potential evaluation using recombinant protein

The results from these experiments would provide comprehensive insights into the functional significance of CBU_1413 in C. burnetii pathogenesis and potential applications in vaccine development.

What role might CBU_1413 play in adipogenesis during C. burnetii infection?

The in silico identification of the Mth938-like domain in CBU_1413 suggests a potential role in preadipocyte differentiation and adipogenesis. This finding opens several investigative paths:

Potential Mechanisms:

• CBU_1413 may interact with host transcription factors that regulate adipocyte differentiation

• The protein could influence lipid metabolism to create a favorable environment for bacterial replication

• It might modulate host cell signaling pathways related to adipogenesis as a method of immune evasion

• CBU_1413 could potentially redirect lipid resources to support the parasitophorous vacuole formation

Experimental Approaches to Investigate These Mechanisms:

• Differentiation assays using preadipocyte cell lines in the presence of purified CBU_1413

• Expression analysis of adipogenesis markers (such as PPARγ, C/EBPα) after exposure to the protein

• Lipid droplet formation assessment through microscopy and biochemical assays

• Metabolomic analysis to track changes in lipid profiles during infection

Understanding CBU_1413's role in adipogenesis could reveal critical aspects of C. burnetii's survival strategy within host cells and potentially identify novel therapeutic targets. The manipulation of host lipid metabolism is a recognized virulence strategy employed by many intracellular pathogens, and CBU_1413 may represent C. burnetii's tool for this purpose .

What are the optimal conditions for recombinant expression of CBU_1413?

Recombinant expression of CBU_1413 requires careful optimization of expression systems and conditions. Based on current research practices:

Expression System Selection:

• E. coli has been successfully used for recombinant CBU_1413 expression, indicating it as a suitable prokaryotic host

• For proteins requiring post-translational modifications, eukaryotic systems like yeast or insect cells may be considered as alternatives

Expression Construct Design:

• Include the mature protein sequence (amino acids 29-259) without signal peptides

• Incorporate an N-terminal His-tag for purification purposes

• Consider codon optimization for the expression host

• Include appropriate promoter systems (T7 promoter commonly used in E. coli)

Culture Conditions Optimization:

• Test various induction temperatures (typically 18-37°C)

• Optimize inducer concentration (IPTG for T7-based systems)

• Determine optimal induction duration (typically 4-24 hours)

• Consider specialized media formulations to enhance protein solubility

Purification Strategy:

• Initial capture using Ni-NTA affinity chromatography targeting the His-tag

• Secondary purification using ion exchange or size exclusion chromatography

• Buffer optimization to maintain protein stability

• Quality control assessment via SDS-PAGE and Western blotting

Following these methodological guidelines has yielded recombinant CBU_1413 with greater than 90% purity suitable for downstream applications in structural studies, functional characterization, and immunological research .

How can CBU_1413 be integrated into vaccine development strategies against Q fever?

Incorporating CBU_1413 into vaccine development requires strategic approaches based on current understanding of protective immunity against C. burnetii:

Antigen Formulation Strategies:

• Use as a single recombinant subunit antigen

• Combination with other immunogenic C. burnetii proteins

• Integration into multi-epitope vaccine constructs

• Formulation with appropriate adjuvants to enhance immunogenicity

Adjuvant Selection Considerations:

• TLR agonists have shown promise in enhancing immune responses against C. burnetii antigens

• Specifically, TLR tri-agonists targeting multiple TLR pathways simultaneously may provide superior immunogenicity

• Emulsion-based adjuvants can be included to create depot effects and enhance antigen presentation

Delivery Methods:

• Protein-based subunit vaccines

• DNA vaccine encoding CBU_1413

• Viral vector-based delivery systems

• Novel conjugation methods like site-specific TLR agonist-antigen conjugation

Evaluation Criteria:

• Humoral immune response (antibody titers, neutralizing capacity)

• Cell-mediated immunity (T cell proliferation, cytokine profiles)

• Protection in challenge models (bacterial burden, clinical signs)

• Safety profile (reactogenicity, adverse events)

Recent research has explored tris-NTA mediated TLR agonist-antigen complexation as an innovative approach to enhance vaccine efficacy. This method provides controlled presentation of both antigen and immune stimulants to antigen-presenting cells, potentially improving the quality and duration of immune responses .

What experimental techniques are most effective for studying protein-ligand interactions of CBU_1413?

Understanding protein-ligand interactions is crucial for elucidating CBU_1413's function and developing potential inhibitors. The following methodological approaches are recommended:

Computational Screening Methods:

• Virtual screening to identify potential binding partners

• Molecular docking to predict binding modes and affinities

• Molecular dynamics simulations to assess complex stability

• Pharmacophore modeling to identify key interaction features

Experimental Binding Assays:

• Surface Plasmon Resonance (SPR) for real-time binding kinetics

• Isothermal Titration Calorimetry (ITC) for thermodynamic parameters

• Microscale Thermophoresis (MST) for binding under native-like conditions

• Fluorescence-based binding assays for high-throughput screening

Structural Characterization:

• X-ray crystallography of protein-ligand complexes

• NMR spectroscopy for solution-state structure determination

• Cryo-EM for larger complexes

• Hydrogen-deuterium exchange mass spectrometry (HDX-MS) for binding site mapping

Functional Validation:

• Enzymatic assays if catalytic activity is predicted

• Cellular assays to assess biological relevance of identified interactions

• Mutagenesis studies of predicted binding site residues

• Competition assays with known ligands or analogs

For CBU_1413 specifically, virtual screening has already identified ligands with high binding affinities, suggesting potential as a drug target against Q fever. Molecular dynamics simulations have confirmed the stability of these complexes, indicating their therapeutic relevance .

How does CBU_1413 compare to other uncharacterized proteins in the C. burnetii genome?

The C. burnetii genome contains numerous uncharacterized proteins that require systematic characterization. Comparing CBU_1413 to other uncharacterized proteins provides valuable context:

Comparative Analysis Framework:

Prioritization Strategy for Research:

• Select proteins with conservation across strains (suggesting essential functions)

• Prioritize proteins with predicted localization in host-interaction settings

• Focus on proteins with identifiable domains that suggest function

• Consider proteins with evidence of expression during infection

CBU_1413 ranks favorably in this prioritization scheme due to its conserved domain, cytoplasmic localization suggesting involvement in cellular processes, and identified ligand-binding capabilities. Its predicted role in host metabolic manipulation also suggests potential significance in pathogenesis .

What is the significance of CBU_1413 in the context of Q fever vaccine development?

The development of effective Q fever vaccines remains a significant public health priority. CBU_1413's potential contribution to this effort can be analyzed in several dimensions:

Antigen Selection Considerations:

• Novel antigens like CBU_1413 may complement traditional vaccine targets

• Uncharacterized proteins often escape immune pressure due to limited recognition

• Combining multiple antigens can provide broader protection against diverse strains

• CBU_1413's cytoplasmic location may result in different immune recognition patterns than surface proteins

Current Vaccine Development Status:

• Subunit vaccine approaches using recombinant C. burnetii proteins show promise

• TLR tri-agonist adjuvant systems have demonstrated enhanced immunogenicity

• Multiple-antigen formulations typically outperform single-antigen vaccines

• Challenge studies in animal models provide critical efficacy data

Immune Response Considerations:

• Analysis of cytokine expression profiles following vaccination

• Monitoring for potential toxicity of vaccine components

• Evaluation of both humoral and cell-mediated immune responses

• Long-term protection assessment through repeated challenge studies

In recent research, TLR tri-agonist approaches combined with selected C. burnetii antigens have shown promising results in animal models. While specific data on CBU_1413's performance in these systems is emerging, its potential as a complementary antigen in multi-target vaccine formulations warrants further investigation .

How might the functional characterization of CBU_1413 contribute to understanding C. burnetii pathogenesis?

Elucidating the function of CBU_1413 has significant implications for understanding C. burnetii's pathogenic mechanisms:

Potential Contributions to Pathogenesis Knowledge:

• If confirmed, the role in adipogenesis could reveal how C. burnetii manipulates host metabolism

• Understanding the protein's interaction partners may identify new pathways targeted during infection

• Structural insights could reveal similarities to virulence factors in other pathogens

• Temporal expression patterns could clarify the stage-specific requirements during infection

Integration with Current Pathogenesis Models:

• C. burnetii survives in acidified parasitophorous vacuoles – CBU_1413 may contribute to this niche adaptation

• The bacterium modulates host immune responses – CBU_1413 might participate in this immunomodulation

• Metabolic adaptation is crucial for intracellular survival – CBU_1413's potential role in lipid metabolism aligns with this requirement

• Chronic infection establishment involves complex host-pathogen interactions – CBU_1413 may be involved in chronicity mechanisms

Translational Implications:

• Identifying critical host-pathogen interaction points for therapeutic targeting

• Developing diagnostic markers based on immune responses to CBU_1413

• Creating attenuated strains through CBU_1413 modification for vaccine development

• Designing inhibitors that target CBU_1413 function as novel therapeutics

The continued characterization of CBU_1413 and similar uncharacterized proteins is essential for developing a comprehensive understanding of C. burnetii pathogenesis and identifying new approaches for prevention and treatment of Q fever .

What are the challenges and strategies for site-specific conjugation of CBU_1413 with immune activators?

Site-specific conjugation of CBU_1413 with immune activators presents both challenges and opportunities for enhanced vaccine development. Several methodological approaches can be considered:

Challenges in Traditional Conjugation Methods:

• Non-specific NHS-mediated conjugation often results in heterogeneous products

• Random attachment can interfere with critical epitopes

• Batch-to-batch variation complicates reproducibility

• Activity loss due to modification of functional residues

Site-Specific Conjugation Strategies:

• tris-NTA Mediated Complexation:

  • Utilizes His-tagged proteins like recombinant CBU_1413

  • Forms stable, non-covalent complexes with tris-NTA modified immune activators

  • Provides controlled orientation of both protein and adjuvant

  • Enhances uptake by antigen-presenting cells

• Enzymatic Approaches:

  • Sortase-mediated conjugation for C-terminal modification

  • Transglutaminase for glutamine/lysine crosslinking

  • Tyrosinase for modification of accessible tyrosine residues

  • Ensures consistent attachment points across protein molecules

• Click Chemistry Applications:

  • Strain-promoted azide-alkyne cycloaddition (SPAAC)

  • Inverse electron demand Diels-Alder reactions

  • Requires introduction of non-canonical amino acids or specific chemical handles

  • Provides high specificity under physiological conditions

The tris-NTA approach is particularly promising for CBU_1413 as it leverages the existing His-tag used in recombinant expression while providing controlled presentation of both antigen and immune activator to antigen-presenting cells .

How can molecular dynamics simulations enhance our understanding of CBU_1413 function?

Molecular dynamics (MD) simulations offer powerful insights into protein behavior that complement experimental approaches:

Simulation Setup and Parameters:

• Prepare protein structure from crystal data or homology models

• Embed in appropriate solvent environment with physiological ion concentrations

• Apply suitable force fields (AMBER, CHARMM, GROMOS)

• Run simulations at multiple timescales (nanoseconds to microseconds)

Key Analyses and Insights:

• Conformational Dynamics:

  • Identify flexible regions through RMSD and RMSF analysis

  • Characterize conformational states and transitions

  • Reveal allosteric communication networks

  • Understand entropic contributions to function

• Ligand Interaction Studies:

  • Probe binding pocket flexibility and accessibility

  • Calculate binding free energies using enhanced sampling methods

  • Identify water-mediated interactions and displacement effects

  • Characterize binding kinetics and residence times

• Functional Mechanism Exploration:

  • Investigate protonation-dependent conformational changes

  • Simulate protein-protein interaction interfaces

  • Analyze effects of post-translational modifications

  • Assess impact of mutations on structure and function

For CBU_1413 specifically, MD simulations have confirmed the stability of protein-ligand complexes identified through virtual screening, providing validation for their potential therapeutic relevance. These simulations have reinforced the protein's potential as a drug target against Q fever .

What are the considerations for developing inhibitors targeting CBU_1413 as potential therapeutics?

Developing inhibitors against CBU_1413 requires a systematic drug discovery approach with several important considerations:

Target Validation Requirements:

• Confirm essentiality of CBU_1413 for C. burnetii survival or virulence

• Establish mechanism of action and functional significance

• Demonstrate druggability through binding site analysis

• Verify accessibility to inhibitors in the intracellular environment

Drug Discovery Pipeline:

• Virtual Screening Approaches:

  • Structure-based screening using docking methods

  • Pharmacophore-based screening for key interaction features

  • Fragment-based design starting with small molecular scaffolds

  • Machine learning approaches to predict binding and ADME properties

• In Vitro Validation:

  • Biochemical assays to confirm direct binding

  • Functional assays to verify inhibition of activity

  • Cellular assays to assess uptake and intracellular efficacy

  • Cytotoxicity evaluation in mammalian cells

• Lead Optimization Considerations:

  • Structure-activity relationship (SAR) studies

  • Pharmacokinetic property enhancement

  • Selectivity improvement to minimize off-target effects

  • Formulation development for appropriate delivery

Therapeutic Potential Analysis:

The current in silico data suggests promising potential for CBU_1413 as a drug target, but extensive experimental validation is required to advance potential inhibitors toward therapeutic application .

What are the key knowledge gaps and future research directions for CBU_1413?

Despite recent advances, significant knowledge gaps remain in our understanding of CBU_1413 and its role in C. burnetii biology and pathogenesis:

Critical Knowledge Gaps:

• Experimental validation of the predicted role in adipogenesis

• Identification of specific host interaction partners

• Temporal expression patterns during different infection phases

• Structure-function relationships at the atomic level

• Essentiality for bacterial survival and virulence

Recommended Research Priorities:

• Structural Biology:

  • Determination of high-resolution crystal or cryo-EM structure

  • Mapping of functional domains and binding sites

  • Comparative analysis with homologous proteins

• Functional Genomics:

  • Development of knockout and conditional expression systems

  • Transcriptomic analysis under various conditions

  • Proteomic studies of interaction networks

• Immunological Characterization:

  • Epitope mapping for antigenicity assessment

  • T cell and B cell response profiling

  • Evaluation as vaccine component in combination formulations

• Therapeutic Development:

  • High-throughput screening for inhibitors

  • Structure-guided drug design

  • Delivery system development for intracellular targeting