Recombinant Coxiella burnetii Uncharacterized protein CBU_1818 (CBU_1818)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard protocol uses 50% glycerol; this can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
CBU_1818; Uncharacterized protein CBU_1818
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-481
Protein Length
full length protein
Species
Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Target Names
CBU_1818
Target Protein Sequence
MSRLPSKTKYHSSHRSLNRKTPLLQRSSETNSLRESGIETASSQLSLAASSYTPIDEEMT ELELKIYLFLFTRALNHKLGYTQENNPDDKAQKAGIDINLDCLNYLLEILYQNLEPQLEK GANLSYHKSSTARKALEYHETLNSRLKKKIAKDAEHKNPLTLLRILNTKTTSISTLIGTG GGIGITGAGAIAGSAAAGIGTAVTVGVLLFYLCWRTTSEYWKKKNAEKLFEHTDQIDNEN IIELVSALSAFYIVKEFEHKNMQKASLKLSLNPESLFEIFQNIYHNKSFRLPSQLPIQKE LKAIAKQAKIDADKIHTHLIEYVNTNKAQSISINLYALIIPSFAYNSEESPTVVKTVAAL HAWLWALDKTLDMKDFLFRNSFEKRLEKVRAGVVKTMKTFKEEVNNVLLETDDSSSGVSL LADEDKTDRVKEWVNKQKLPSPGALSPIKSASHLALFSSLREQKDKAVNSSGSRLSLRLG N
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Coxiella burnetii Uncharacterized Protein CBU_1818?

Coxiella burnetii Uncharacterized Protein CBU_1818 (Uniprot ID: Q83AR2) is a protein encoded by the CBU_1818 gene in the Coxiella burnetii genome (strain RSA 493/Nine Mile phase I). The protein consists of 481 amino acids with an expression region spanning residues 1-481 . Despite being classified as "uncharacterized," preliminary research suggests it may play a role in C. burnetii pathogenesis, similar to other proteins involved in host-pathogen interactions during Q fever development.

Why are researchers interested in studying uncharacterized proteins from C. burnetii?

Researchers are interested in uncharacterized C. burnetii proteins for several compelling reasons. First, C. burnetii poses a significant global public health threat as the causative agent of Q fever, necessitating better understanding of its molecular mechanisms . Second, within the genomic landscape of C. burnetii, numerous hypothetical proteins remain unidentified, representing potential targets for diagnostic and therapeutic interventions . Third, characterizing these proteins can reveal novel virulence factors and pathogenicity mechanisms, providing insights into how the bacterium survives within the lysosomal network of host cells . Finally, identifying the functions of these proteins may reveal new drug targets for more effective Q fever treatments .

What is the predicted structure and cellular location of CBU_1818?

Based on in silico analysis approaches similar to those used for other C. burnetii proteins, CBU_1818 is likely a cytoplasmic protein. This prediction can be made through subcellular localization tools that analyze amino acid sequences for targeting signals and physicochemical properties . The protein's structure can be predicted using various bioinformatics tools to assess its primary, secondary, and tertiary structures . While specific information about CBU_1818's structure is limited in the available literature, researchers typically employ tools such as homology modeling, molecular dynamics simulations, and domain prediction software to elucidate potential structural features of uncharacterized proteins .

What expression systems are most suitable for producing recombinant CBU_1818?

For expression of recombinant CBU_1818, E. coli-based systems are commonly employed due to their efficiency and high yield. Based on protocols for other C. burnetii proteins, the gene can be cloned into an expression vector with a histidine tag or other affinity tag for purification purposes . Typically, the CBU_1818 gene would be overexpressed in E. coli BL21(DE3) or similar strains under controlled induction conditions . For optimal expression, researchers should consider codon optimization for E. coli, as C. burnetii may have different codon usage patterns. The recombinant protein can then be purified using affinity chromatography such as Ni-NTA for His-tagged proteins, followed by additional purification steps like ion exchange or size exclusion chromatography if higher purity is required.

What are the basic storage and handling recommendations for recombinant CBU_1818?

Recombinant CBU_1818 should be stored in a Tris-based buffer with 50% glycerol at -20°C for regular storage or -80°C for extended storage periods . Repeated freeze-thaw cycles should be avoided to prevent protein degradation . For short-term work, working aliquots can be stored at 4°C for up to one week . When handling the protein, standard precautions for recombinant proteins should be followed, including the use of sterile technique to prevent contamination. The optimal pH and salt concentration for stability may vary, but typically a neutral pH (7.0-7.5) with moderate salt concentration (150-300 mM NaCl) works well for most recombinant proteins.

What methodologies are most effective for functional characterization of CBU_1818?

For comprehensive functional characterization of CBU_1818, researchers should employ multiple complementary approaches:

  • Protein-Protein Interaction Studies: Affinity tag purification mass spectrometry (AP-MS) can identify potential binding partners of CBU_1818, providing clues about its cellular function . This approach has successfully mapped interactions between C. burnetii effectors and host proteins, revealing functional implications.

  • Genetic Manipulation: Attempts to create deletion mutants through homologous recombination, though challenging as seen with other C. burnetii proteins, can provide insights into the protein's essentiality . Alternatively, overexpression or knockdown approaches using plasmid constructs (like pJB-Kan-3×FLAG) can help assess the protein's role in bacterial physiology and virulence .

  • Structural Analysis: X-ray crystallography or cryo-EM could elucidate the three-dimensional structure, potentially revealing functional domains. Molecular dynamics simulations can further assess structural stability and ligand interactions .

  • Domain Mapping: Creating truncation mutants to identify functional regions, as demonstrated with other C. burnetii proteins, can pinpoint active sites or interaction interfaces .

  • In vitro and Cell-Based Assays: Based on predicted functions from bioinformatics analysis, specific biochemical assays can test enzymatic activities or cellular effects when the protein is introduced into host cells.

How can researchers determine if CBU_1818 functions as a virulence factor in C. burnetii infection?

To determine if CBU_1818 functions as a virulence factor, researchers should implement the following methodological approach:

  • Translocation Assays: Utilize β-lactamase-based translocation assays to determine if CBU_1818 is secreted into host cells during infection, similar to methods used for other C. burnetii effectors .

  • Gene Expression Analysis: Measure CBU_1818 expression levels during different phases of infection using RT-qPCR to determine if expression patterns correlate with virulence.

  • Infection Models: Compare wild-type C. burnetii with strains overexpressing CBU_1818 (using plasmids like pJB-Kan-3×FLAG) or with reduced expression (via antisense RNA or CRISPR interference) in cellular and animal infection models .

  • Bacterial Replication Assessment: Quantify bacterial genome equivalents (GE) using qPCR to measure replication efficiency under different conditions, as done with other virulence factors .

  • Host Response Analysis: Evaluate host cell responses, including cytokine production, cell death mechanisms, and intracellular trafficking patterns, following infection with strains differentially expressing CBU_1818.

  • Protein Interaction Studies: Identify host protein targets using co-immunoprecipitation and mass spectrometry to elucidate potential mechanisms of virulence .

What experimental challenges are commonly encountered when working with recombinant CBU_1818, and how can they be overcome?

Researchers working with recombinant CBU_1818 often encounter several experimental challenges:

  • Protein Solubility Issues:

    • Challenge: Like many bacterial proteins, CBU_1818 may form inclusion bodies when overexpressed in E. coli.

    • Solution: Optimize expression conditions (temperature, inducer concentration, growth media), use solubility-enhancing fusion tags (SUMO, MBP, GST), or employ co-expression with chaperones. Alternatively, inclusion bodies can be solubilized and refolded using gradual dilution or dialysis methods.

  • Purification Difficulties:

    • Challenge: Obtaining high purity and yield while maintaining native conformation.

    • Solution: Implement multi-step purification strategies combining affinity chromatography with ion exchange and size exclusion chromatography. Use mild detergents if the protein has hydrophobic regions.

  • Protein Stability Issues:

    • Challenge: Maintaining stability during storage and experimental procedures.

    • Solution: Optimize buffer conditions (pH, salt concentration, additives like glycerol), store in small aliquots to avoid freeze-thaw cycles, and add protease inhibitors to prevent degradation .

  • Functional Validation:

    • Challenge: Confirming that the recombinant protein retains its native functionality.

    • Solution: Compare multiple expression systems and purification strategies, validate proper folding using circular dichroism or limited proteolysis, and develop activity assays based on predicted functions.

  • Antibody Generation:

    • Challenge: Developing specific antibodies for detection and localization studies.

    • Solution: Use purified recombinant CBU_1818 to generate polyclonal or monoclonal antibodies, carefully validating specificity against both recombinant protein and native protein in C. burnetii lysates.

How can researchers use bioinformatics approaches to predict the function of CBU_1818?

Researchers can employ a comprehensive bioinformatics pipeline to predict CBU_1818 function:

  • Sequence Analysis:

    • Perform BLAST, PSI-BLAST, and HHpred searches against protein databases to identify distant homologs.

    • Use Multiple Sequence Alignments (MSAs) to identify conserved residues that may be functionally important.

    • Analyze the amino acid composition and sequence motifs using tools like PROSITE, PFAM, and InterPro.

  • Structural Prediction and Analysis:

    • Generate 3D structural models using homology modeling (if templates are available) or ab initio modeling using tools like AlphaFold2 or RoseTTAFold.

    • Analyze the predicted structure for potential binding pockets, catalytic sites, or interaction interfaces.

    • Compare structural features with proteins of known function using structural alignment tools.

  • Function Prediction:

    • Use tools like ProFunc, COFACTOR, and COACH to predict protein function based on structural features.

    • Employ Gene Ontology (GO) term prediction tools to suggest potential biological processes, molecular functions, and cellular components.

    • Analyze genomic context and gene neighborhood to identify potential functional associations.

  • Molecular Dynamics Simulations:

    • Perform molecular dynamics simulations to understand protein flexibility and potential conformational changes.

    • Use virtual screening to identify potential ligands that may bind to CBU_1818, providing clues about its function .

  • Integration of Multiple Approaches:

    • Combine results from multiple prediction methods and develop a consensus prediction.

    • Prioritize experimental validation based on the most confident predictions.

This integrated approach has been successfully applied to other uncharacterized proteins from C. burnetii, revealing potential roles in cellular processes and identifying conserved domains like Mth938, which can suggest functional roles in processes such as adipogenesis .

What role might CBU_1818 play in host-pathogen interactions based on current knowledge of C. burnetii effector proteins?

While specific information about CBU_1818's role in host-pathogen interactions is limited, insights can be drawn from research on other C. burnetii effector proteins:

  • Potential T4SS Effector: CBU_1818 might be a Type IV Secretion System (T4SS) effector, similar to the 150+ effectors already identified in C. burnetii that are translocated into host cells through the Dot/Icm system . If so, it would likely manipulate host cellular processes to promote bacterial survival and replication.

  • Host Cellular Targets: Based on the protein-protein interaction (PPI) maps generated for other C. burnetii effectors, CBU_1818 might interact with specific host proteins to:

    • Modify vesicular trafficking to establish and maintain the Coxiella-containing vacuole (CCV)

    • Interfere with immune signaling pathways to evade host defenses

    • Manipulate host cell death mechanisms to prevent premature cell death

    • Alter cellular metabolism to create a favorable environment for bacterial replication

  • Structural Insights: If CBU_1818 contains any recognizable domains or structural features similar to other characterized effectors, it might function through:

    • Enzymatic activities (e.g., phosphatase, kinase, ubiquitin ligase)

    • Protein-protein interaction modules that sequester or redirect host factors

    • DNA/RNA-binding domains that alter host gene expression

  • Temporal Expression: The timing of CBU_1818 expression during infection could indicate its role in early establishment of infection, maintenance of the replicative niche, or preparation for cell exit and subsequent infection cycles.

To experimentally validate these hypotheses, researchers should consider using techniques like the β-lactamase translocation assay to confirm if CBU_1818 is secreted into host cells, and AP-MS to identify its host interaction partners .

How should researchers design experiments to identify potential binding partners of CBU_1818?

Researchers can employ the following methodological approach to identify binding partners of CBU_1818:

  • Affinity Tag Purification-Mass Spectrometry (AP-MS):

    • Express CBU_1818 with an affinity tag (e.g., FLAG, Strep, or HA) in mammalian cells or during C. burnetii infection.

    • Perform immunoprecipitation using antibodies against the tag.

    • Analyze co-precipitated proteins using LC-MS/MS.

    • Filter results against appropriate controls to identify specific interactions.

    • This approach has been successful in identifying interactions between other C. burnetii effectors and host proteins .

  • Yeast Two-Hybrid (Y2H) Screening:

    • Clone CBU_1818 into a bait vector and screen against a human cDNA library.

    • Validate positive interactions through secondary screens.

    • This method can identify direct binary interactions but may have limitations for membrane or toxic proteins.

  • Proximity-Based Labeling:

    • Fuse CBU_1818 to a promiscuous biotin ligase (BioID) or peroxidase (APEX2).

    • Express the fusion protein in host cells and add biotin.

    • Purify biotinylated proteins and identify them by mass spectrometry.

    • This approach can capture transient interactions and works in the native cellular context.

  • Co-Immunoprecipitation Validation:

    • Co-express CBU_1818 and candidate interacting proteins with different tags.

    • Perform reciprocal co-immunoprecipitations to confirm interactions.

    • Use truncation mutants to map interaction domains, as demonstrated with other C. burnetii effectors .

  • GST Pull-Down Assays:

    • Express CBU_1818 as a GST fusion protein in E. coli.

    • Incubate purified GST-CBU_1818 with mammalian cell lysates.

    • Pull down using glutathione beads and identify bound proteins by Western blotting or mass spectrometry.

    • This technique can validate direct interactions in vitro .

TechniqueAdvantagesLimitationsBest For
AP-MSIdentifies multiple interactions in cellular contextMay include indirect interactionsGlobal interaction screening
Y2HDetects direct binary interactionsHigh false positive rateBinary interaction screening
Proximity LabelingCaptures transient and weak interactionsMay label proximal non-interacting proteinsSpatial interaction networks
Co-IPConfirms interactions in cellular contextRequires antibodies or tagsValidation of candidate interactions
GST Pull-DownConfirms direct physical interactionsIn vitro system may not reflect in vivo conditionsBiochemical validation

What controls and validation methods are essential when studying CBU_1818 function in infection models?

When studying CBU_1818 function in infection models, researchers should implement the following controls and validation methods:

  • Genetic Controls:

    • Wild-type C. burnetii: Establish baseline infection parameters with unmodified bacteria.

    • Vector-only Control: Include bacteria carrying the empty vector for overexpression studies.

    • Non-targeting Control: For knockdown studies, include non-targeting siRNA or CRISPR controls.

    • Complementation: Restore CBU_1818 expression in knockdown strains to confirm phenotype specificity.

    • Other C. burnetii Protein Controls: Include C. burnetii proteins with known functions (e.g., CBU1780, CBU1387) as comparison controls .

  • Experimental Validation Methods:

    • Multiple Cell Types: Test effects in different relevant cell types (e.g., THP-1, HeLa, primary macrophages).

    • Multiple Timepoints: Assess phenotypes at various stages of infection (early, middle, late).

    • Dose-Dependency: Test multiple MOIs (multiplicities of infection) to establish dose-response relationships.

    • Multiple Quantification Methods: Combine different techniques to measure bacterial replication:

      • qPCR for genome equivalents (GE)

      • Fluorescence microscopy for bacterial burden using fluorescent C. burnetii strains

      • Colony-forming unit (CFU) assays when applicable

  • Technical Controls:

    • Expression Verification: Confirm CBU_1818 expression/knockdown by Western blot or qRT-PCR.

    • Cytotoxicity Assessment: Monitor host cell viability to ensure phenotypes aren't due to cell death.

    • Protein Localization: Verify proper localization of CBU_1818 within bacteria or host cells using immunofluorescence.

    • Biological Replicates: Perform at least three independent experiments with technical replicates.

    • Statistical Analysis: Apply appropriate statistical tests based on data distribution.

  • Phenotypic Validation:

    • Multiple Phenotypic Readouts: Assess various aspects of infection:

      • Bacterial replication

      • Vacuole formation and characteristics

      • Host cell response (cytokine production, cell death)

      • Transcriptional changes

    • Rescue Experiments: Test if phenotypes can be rescued by known pathway modulators.

How can researchers develop a reliable immunodetection system for CBU_1818 in both recombinant and native contexts?

Developing a reliable immunodetection system for CBU_1818 requires a systematic approach:

  • Antibody Generation Strategy:

    • Recombinant Protein Approach: Express and purify full-length CBU_1818 with an affinity tag in E. coli or another suitable expression system .

    • Peptide Approach: Identify immunogenic epitopes using in silico prediction tools and synthesize peptides corresponding to these regions.

    • Immunization: Immunize rabbits or mice with the purified protein or peptide conjugates using a standard immunization protocol with appropriate adjuvants.

    • Alternative: For faster results, consider generating tag-specific antibodies by expressing tagged versions of CBU_1818 in C. burnetii.

  • Antibody Purification and Validation:

    • Purify antibodies using affinity chromatography (protein A/G and antigen-specific columns).

    • Validate specificity through Western blotting against:

      • Purified recombinant CBU_1818

      • C. burnetii lysates (wild-type vs. CBU_1818 overexpression or knockdown)

      • Unrelated bacterial lysates to confirm specificity

    • Determine optimal antibody concentration through titration experiments.

    • Validate for multiple applications (Western blot, immunofluorescence, ELISA, immunoprecipitation).

  • Developing Detection Assays:

    • Western Blot Protocol:

      • Optimize lysis conditions to efficiently extract CBU_1818 from C. burnetii

      • Determine optimal protein amount, blocking conditions, antibody dilutions, and detection methods

      • Include appropriate controls (recombinant protein, overexpression lysates)

    • Immunofluorescence Protocol:

      • Test different fixation methods (paraformaldehyde, methanol)

      • Optimize permeabilization conditions

      • Determine antibody dilutions and incubation times

      • Use confocal microscopy to assess co-localization with bacterial and host markers

  • Quantitative Assays:

    • ELISA Development:

      • Establish standard curves using purified recombinant CBU_1818

      • Optimize coating conditions, blocking buffers, and detection systems

      • Validate assay sensitivity and specificity

    • Flow Cytometry:

      • Develop protocols for intracellular staining of CBU_1818 in infected cells

      • Optimize fixation, permeabilization, and staining conditions

  • Multiplexed Detection:

    • Develop co-staining protocols to simultaneously detect CBU_1818 and other bacterial or host proteins using differently labeled secondary antibodies.

    • Validate antibody compatibility in multiplex assays to avoid cross-reactivity.

What are the most effective approaches for studying post-translational modifications of CBU_1818?

To effectively study post-translational modifications (PTMs) of CBU_1818, researchers should employ a multi-faceted approach:

  • Predictive Analysis:

    • Use bioinformatics tools to predict potential PTM sites:

      • Phosphorylation (NetPhos, GPS)

      • Glycosylation (NetNGlyc, NetOGlyc)

      • Ubiquitination (UbPred)

      • SUMOylation (SUMOplot)

      • Acetylation (PAIL, GPS-PAIL)

    • Prioritize conserved sites identified through multiple sequence alignments with homologs.

  • Mass Spectrometry-Based Approaches:

    • Sample Preparation:

      • Express and purify CBU_1818 from both recombinant systems and native C. burnetii.

      • For phosphorylation studies, treat samples with phosphatase inhibitors during purification.

      • Perform in-gel or in-solution digestion with appropriate proteases (trypsin, Lys-C, or combinations).

    • Enrichment Strategies:

      • For phosphorylation: IMAC, titanium dioxide, or phospho-specific antibodies

      • For glycosylation: lectin affinity chromatography or hydrazide chemistry

      • For ubiquitination: di-Gly remnant antibodies after trypsin digestion

    • LC-MS/MS Analysis:

      • Use high-resolution mass spectrometry (Orbitrap or similar)

      • Employ data-dependent acquisition (DDA) or data-independent acquisition (DIA)

      • Implement neutral loss scanning for certain PTMs (e.g., phosphorylation)

    • Data Analysis:

      • Search against C. burnetii protein database with appropriate PTM parameters

      • Validate identifications using false discovery rate control

      • Quantify modification site occupancy when possible

  • Site-Directed Mutagenesis:

    • Generate mutants with altered PTM sites (e.g., S/T to A for phosphorylation, K to R for ubiquitination)

    • Express both wild-type and mutant proteins

    • Compare functional differences to assess the role of specific modifications

    • Use complementation experiments in CBU_1818-depleted bacteria to assess the importance of PTM sites

  • Specific PTM Detection Methods:

    • Western Blotting:

      • Use PTM-specific antibodies (anti-phospho, anti-ubiquitin, etc.)

      • Compare detection before and after treatment with modifying/demodifying enzymes

    • Radioactive Labeling:

      • For phosphorylation, perform in vitro kinase assays with γ-³²P-ATP

      • For glycosylation, use metabolic labeling with radioactive sugar precursors

    • Chemical Labeling:

      • Bio-orthogonal labeling of PTMs using click chemistry

      • Proximity labeling to identify enzymes responsible for CBU_1818 modifications

  • Temporal and Condition-Dependent Studies:

    • Analyze PTM changes during different stages of C. burnetii infection

    • Compare modifications under different stress conditions

    • Assess the impact of host cell type on CBU_1818 modifications

How can CRISPR-Cas9 technology be applied to study CBU_1818 function in C. burnetii?

Applying CRISPR-Cas9 technology to study CBU_1818 in C. burnetii requires specialized approaches due to the pathogen's intracellular lifestyle and genetic manipulation challenges:

  • Gene Knockout Strategies:

    • Design and Delivery:

      • Design sgRNAs targeting CBU_1818 using algorithms optimized for bacterial genomes

      • Clone sgRNAs into a C. burnetii-compatible vector expressing Cas9

      • Include homology-directed repair templates to replace CBU_1818 with a selectable marker

      • Use electroporation to transform axenic C. burnetii cultures

    • Selection and Verification:

      • Apply appropriate antibiotic selection based on the resistance marker

      • Screen colonies by PCR to confirm successful knockouts

      • Verify gene deletion by whole-genome sequencing to detect off-target effects

      • Confirm protein absence by Western blotting

  • CRISPR Interference (CRISPRi) for Knockdown:

    • System Setup:

      • Express catalytically inactive Cas9 (dCas9) in C. burnetii

      • Design sgRNAs targeting the promoter region or early coding sequence of CBU_1818

      • Use inducible promoters to control dCas9 expression for temporal studies

    • Validation and Analysis:

      • Confirm knockdown efficiency by qRT-PCR and Western blotting

      • Evaluate phenotypic effects at different levels of knockdown

      • Perform complementation with a CRISPRi-resistant CBU_1818 variant

  • CRISPR Activation (CRISPRa):

    • Adapt CRISPR activation systems for use in C. burnetii by fusing transcriptional activators to dCas9

    • Target the CBU_1818 promoter to upregulate expression

    • Compare phenotypes with conventional overexpression approaches

  • Domain Mapping with CRISPR:

    • Use CRISPR-Cas9 to generate targeted deletions or mutations in specific domains of CBU_1818

    • Create a library of domain mutants to map functional regions

    • Express mutated variants to identify critical residues for function

  • Tracking CBU_1818 with CRISPR:

    • Implement CRISPR-based tagging to introduce fluorescent or affinity tags at the endogenous CBU_1818 locus

    • Use this approach to track protein localization during infection without overexpression artifacts

    • Combine with proximity labeling to identify interaction partners in situ

  • Experimental Considerations:

    • Essential Gene Handling: If CBU_1818 is essential (as suggested by difficulties in generating knockouts for some C. burnetii genes ), use:

      • Conditional knockout strategies with inducible promoters

      • Partial knockdown with CRISPRi to study hypomorphic phenotypes

      • Complementation with mutant alleles before knockout of the native gene

    • Off-Target Minimization:

      • Use computational tools to predict and avoid off-target effects

      • Validate phenotypes with multiple sgRNAs targeting different regions of CBU_1818

      • Perform whole-genome sequencing to confirm specificity

  • Alternative Approaches If CRISPR Proves Challenging:

    • Group II intron-based mutagenesis (TargeTron)

    • Antisense RNA strategies

    • Heterologous expression in Legionella pneumophila, which has a similar T4SS and can deliver C. burnetii effectors

How should researchers interpret conflicting results between in vitro and in vivo studies of CBU_1818?

When faced with conflicting results between in vitro and in vivo studies of CBU_1818, researchers should implement the following interpretative framework:

What bioinformatics tools and databases are most valuable for analyzing structural and functional aspects of CBU_1818?

Researchers studying CBU_1818 should utilize the following bioinformatics resources, organized by analysis category:

  • Sequence Analysis Tools:

    • Primary Sequence Analysis:

      • BLAST/PSI-BLAST (NCBI): Identify homologs in other organisms

      • HHpred: Detect remote homologs through hidden Markov model comparisons

      • HMMER: Search for conserved domains using profile HMMs

    • Multiple Sequence Alignment:

      • Clustal Omega: Align CBU_1818 with homologs

      • MUSCLE: Alternative alignment algorithm for evolutionarily diverse sequences

      • T-Coffee: High-accuracy alignments for structure prediction

    • Sequence Feature Prediction:

      • SignalP: Predict signal peptides

      • TMHMM: Identify transmembrane helices

      • ProtParam: Analyze physicochemical properties

      • ProtScale: Generate amino acid scales for various properties

  • Structural Analysis Resources:

    • Structure Prediction:

      • AlphaFold2: State-of-the-art protein structure prediction

      • RoseTTAFold: Alternative deep learning-based structure prediction

      • I-TASSER: Hierarchical approach to structure prediction

      • SWISS-MODEL: Homology modeling if templates are available

    • Structure Analysis:

      • PyMOL/Chimera: Visualize and analyze predicted structures

      • PDBeFold: Compare predicted structures with known proteins

      • ProSA: Validate structural models

      • CASTp: Identify potential binding pockets and cavities

  • Functional Prediction Tools:

    • Domain and Motif Identification:

      • InterPro: Integrated resource for protein families and domains

      • Pfam: Database of protein families

      • PROSITE: Database of protein domains, families and functional sites

      • SMART: Simple Modular Architecture Research Tool

    • Function Prediction:

      • COFACTOR: Structure-based protein function prediction

      • DeepFRI: Deep learning approach for function prediction

      • EFICAz: Enzyme function inference

      • ProFunc: Comprehensive function prediction server

  • Post-Translational Modification Prediction:

    • Phosphorylation: NetPhos, GPS, PhosphoSitePlus

    • Glycosylation: NetNGlyc, NetOGlyc, GlycoMine

    • Ubiquitination: UbPred, UbiSite

    • Methylation: MeMo, GPS-MSP

    • SUMOylation: GPS-SUMO, SUMOplot

  • Specialized C. burnetii Resources:

    • Pathogen-Host Interaction Database (PHI-base): Curated database of genes proven to affect pathogen-host interactions

    • COXBASEdb: Specialized database for Coxiella genome information

    • SecReT4: Database of bacterial type IV secretion systems

    • EffectiveDB: Prediction of bacterial secreted proteins

    • UniProt Entry Q83AR2: Curated information specific to CBU_1818

  • Molecular Dynamics and Docking:

    • GROMACS/NAMD: Molecular dynamics simulations to study protein dynamics

    • AutoDock Vina: Molecular docking to predict protein-ligand interactions

    • HADDOCK: Protein-protein docking

    • MDWeb: User-friendly interface for setting up molecular dynamics simulations

  • Integrated Analysis Platforms:

    • Galaxy: Web-based platform for accessible bioinformatic analysis

    • BLAST2GO: Functional annotation, especially for novel proteins

    • STRING: Protein-protein interaction networks and functional enrichment

    • Cytoscape: Visualization of molecular interaction networks

Analysis TypePrimary ToolsSecondary ToolsDatabase Resources
Sequence AnalysisBLAST, HHpred, Clustal OmegaHMMER, MUSCLE, T-CoffeeUniProt, NCBI Protein
Structure PredictionAlphaFold2, I-TASSERRoseTTAFold, SWISS-MODELPDB, AlphaFold DB
Function PredictionInterPro, Pfam, COFACTORDeepFRI, ProFuncGene Ontology, KEGG
PTM AnalysisNetPhos, NetNGlyc, UbPredGPS-SUMO, MeMoPhosphoSitePlus
C. burnetii SpecificCOXBASEdb, SecReT4EffectiveDB, PHI-baseUniProt (Q83AR2)
Molecular SimulationGROMACS, AutoDock VinaHADDOCK, MDWebZinc Database

How can researchers design a comprehensive host response study to understand the impact of CBU_1818 on cellular processes?

To design a comprehensive host response study examining CBU_1818's impact on cellular processes, researchers should implement the following methodological framework:

  • Experimental System Design:

    • Cell Types:

      • Primary human macrophages (most relevant to natural infection)

      • THP-1 derived macrophages (standardized model)

      • Epithelial cells (HeLa, A549) for comparison

      • Cell lines from different tissues to assess tissue tropism

    • Expression Strategies:

      • Transfection of CBU_1818 expression constructs

      • Lentiviral transduction for stable expression

      • Inducible expression systems to control timing and levels

      • Fluorescent tags for localization studies (mCherry-tagged CBU_1818)

    • Controls:

      • Empty vector controls

      • Unrelated C. burnetii proteins (e.g., CBU1780, CBU1387)

      • Inactive CBU_1818 mutants

      • Host cell-specific controls (e.g., PSMB5 knockdown/overexpression)

  • Multi-Omics Analysis Approach:

    Analysis TypeMethodologyKey MeasurementsExpected Insights
    TranscriptomicsRNA-SeqGlobal gene expression changesPathway activation, host response signatures
    ProteomicsLC-MS/MSProtein abundance changesPost-transcriptional regulation, protein stability
    PhosphoproteomicsPhospho-enrichment + LC-MS/MSSignaling pathway activationKinase cascades affected by CBU_1818
    MetabolomicsTargeted and untargeted MSMetabolic pathway alterationsEffects on cellular metabolism
    InteractomicsAP-MS, BioIDDirect and indirect CBU_1818 binding partnersMolecular targets of CBU_1818
  • Cellular Process Assays:

    • Vesicular Trafficking:

      • Live-cell imaging with fluorescent markers for endosomal/lysosomal compartments

      • Co-localization analysis with vacuolar markers

      • Transferrin/dextran uptake and trafficking assays

    • Cell Death and Survival:

      • Apoptosis assays (Annexin V, caspase activation)

      • Necrosis measurements (LDH release)

      • Autophagy monitoring (LC3 conversion, p62 degradation)

    • Immune Signaling:

      • NF-κB activation (reporter assays, nuclear translocation)

      • Inflammasome activation (IL-1β secretion, ASC speck formation)

      • Cytokine/chemokine profiling (multiplex ELISA)

      • Type I IFN response monitoring (ISRE reporters)

    • Proteasome Function:

      • Proteasome activity assays using fluorogenic substrates

      • Ubiquitinated protein accumulation

      • Proteasome subunit interactions, similar to what was found with CBU0425 (CirB)

  • Advanced Microscopy Approaches:

    • Super-Resolution Microscopy:

      • Track CBU_1818 localization with nanometer precision

      • Co-localization with host organelles and proteins

    • Live-Cell Imaging:

      • Real-time monitoring of CBU_1818 trafficking

      • Host response dynamics using fluorescent reporters

    • FRET/BRET Analysis:

      • Detect direct protein-protein interactions in live cells

      • Measure conformational changes upon binding

  • Temporal and Dose-Response Analysis:

    • Time-Course Experiments:

      • Early (minutes to hours) host responses

      • Late (days) adaptive responses

      • Compare with infection timeline of C. burnetii

    • Expression Level Variation:

      • Titrate CBU_1818 expression to determine dose-dependent effects

      • Compare with estimated native expression levels during infection

  • Systems Biology Integration:

    • Integrate all datasets using pathway and network analysis

    • Identify key nodes and pathways affected by CBU_1818

    • Generate testable hypotheses about CBU_1818 function

    • Create predictive models of CBU_1818's role in infection

  • Validation in Infection Models:

    • Compare findings from ectopic expression with actual C. burnetii infection

    • Use CBU_1818-overexpressing and knockdown C. burnetii strains

    • Assess if identified pathways are similarly modulated during infection

    • Test if blocking identified pathways affects C. burnetii replication

This comprehensive approach will provide a systems-level understanding of how CBU_1818 influences host cellular processes, similar to successful studies with other C. burnetii effectors like CirB (CBU0425) .

What are the most reliable methods for quantifying CBU_1818 expression levels during different phases of C. burnetii infection?

To reliably quantify CBU_1818 expression during different infection phases, researchers should employ multiple complementary methods:

  • Transcriptional Analysis:

    • RT-qPCR:

      • Design CBU_1818-specific primers with validated efficiency

      • Use multiple reference genes for normalization (e.g., 16S rRNA, rpoS)

      • Apply appropriate extraction methods to obtain high-quality RNA from infected cells

      • Include controls for host RNA contamination

      • Implement absolute quantification using standard curves

    • RNA-Seq:

      • Perform differential RNA-Seq to distinguish primary transcripts

      • Use rRNA depletion methods optimized for bacterial-host mixed samples

      • Employ specialized analysis pipelines to separate bacterial from host reads

      • Normalize using spike-in controls and validated reference genes

      • Compare CBU_1818 expression with global gene expression patterns

    • Single-Cell Approaches:

      • Use fluorescent reporters fused to the CBU_1818 promoter

      • Implement RNA-FISH to detect CBU_1818 transcripts in individual bacteria

      • Apply single-cell RNA-Seq to capture heterogeneity in expression

  • Protein-Level Quantification:

    • Western Blotting:

      • Develop specific antibodies against CBU_1818 or use epitope tags

      • Optimize extraction procedures to efficiently recover CBU_1818

      • Use recombinant protein standards for quantification

      • Implement fluorescent secondary antibodies for wider linear range

      • Normalize to constitutively expressed C. burnetii proteins

    • Mass Spectrometry:

      • Apply targeted proteomics (PRM, SRM) for sensitive quantification

      • Use isotopically labeled peptide standards for absolute quantification

      • Implement sample fractionation to enhance detection of low-abundance proteins

      • Focus on proteotypic peptides unique to CBU_1818

      • Combine with global proteomics to assess relative to other bacterial proteins

    • Flow Cytometry:

      • Express fluorescent protein fusions to CBU_1818

      • Use intracellular staining with CBU_1818-specific antibodies

      • Gate on bacterial population using general C. burnetii markers

      • Quantify expression on a per-bacterium basis

  • Temporal Sampling Strategy:

    • Define Infection Phases:

      • Early phase: 0-24 hours post-infection (bacterial attachment and entry)

      • Middle phase: 24-72 hours (establishment of replicative vacuole)

      • Late phase: 72+ hours (active replication and persistence)

      • Very late phase: 7+ days (preparation for cell exit)

    • Synchronized Infection:

      • Use pulse infection protocols to ensure synchronized entry

      • Consider physical separation methods to remove extracellular bacteria

      • Implement antibiotic protection assays for clean starting points

    • Continuous Monitoring:

      • Develop reporter systems for real-time monitoring

      • Implement live-cell imaging for single-cell dynamics

      • Use microfluidic systems for continuous sampling

  • Data Integration and Normalization:

    • Multi-Method Validation:

      • Compare results across methods to identify consistent patterns

      • Address discrepancies between RNA and protein levels

      • Account for method-specific biases

    • Normalization Strategies:

      • Normalize to bacterial load (genome equivalents by qPCR)

      • Use constitutively expressed genes/proteins as internal references

      • Apply global normalization methods for -omics datasets

    • Statistical Analysis:

      • Implement appropriate statistical tests for time-series data

      • Account for biological replicates and technical variation

      • Use curve-fitting approaches for expression kinetics

  • Experimental Validation:

    • Expression Manipulation:

      • Alter CBU_1818 expression using inducible systems

      • Correlate expression levels with phenotypic outcomes

      • Verify timing-dependent effects by stage-specific induction

    • Stimulation Experiments:

      • Test if expression responds to various host cell conditions

      • Examine effects of stress conditions on expression

      • Assess if expression correlates with specific environmental triggers

This multi-method approach provides robust quantification of CBU_1818 expression dynamics throughout the C. burnetii infection cycle, enabling correlations with phenotypic effects and functional roles at different stages.

How can researchers differentiate between direct and indirect effects of CBU_1818 on host cell pathways?

Differentiating between direct and indirect effects of CBU_1818 on host cell pathways requires a systematic, multi-pronged approach:

  • Direct Interaction Identification:

    • Protein-Protein Interaction Assays:

      • Yeast two-hybrid (Y2H) screening to identify direct binary interactions

      • Co-immunoprecipitation with recombinant CBU_1818 and candidate host proteins

      • GST-pulldown assays with purified components to confirm direct binding

      • FRET/BRET analysis to detect interactions in living cells

      • Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to measure binding kinetics and affinity

    • Domain Mapping:

      • Create truncation mutants to identify minimal interaction domains

      • Perform alanine scanning mutagenesis to identify critical residues

      • Use competition assays with peptides derived from binding interfaces

      • Apply approaches similar to those used for mapping CirB interactions with proteasome subunits

    • Structural Studies:

      • Determine co-crystal structures of CBU_1818 with host targets

      • Use cross-linking coupled with mass spectrometry (XL-MS) to map interaction interfaces

      • Apply hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify binding regions

  • Temporal Resolution Analysis:

    • Rapid Induction Systems:

      • Use tetracycline-inducible or similar systems for tight temporal control

      • Analyze early events (seconds to minutes) after CBU_1818 induction

      • Compare timing of different pathway alterations to establish cause-effect relationships

    • Time-Course Profiling:

      • Perform high-resolution time-course experiments after CBU_1818 introduction

      • Use phosphoproteomics to track signaling events with minute-by-minute resolution

      • Apply mathematical modeling to infer causal relationships from temporal data

    • Pulse-Chase Experiments:

      • Use brief expression pulses followed by protein degradation

      • Monitor how long effects persist after CBU_1818 removal

      • Distinguish between catalytic activities (persistent) and scaffold functions (transient)

  • Biochemical Activity Assays:

    • Enzymatic Function Testing:

      • Test for common enzymatic activities (kinase, phosphatase, protease, etc.)

      • Use purified components to establish direct enzymatic effects

      • Measure activity in the presence and absence of potential cofactors

      • Create catalytically inactive mutants to separate enzymatic and scaffolding functions

    • Reconstitution Experiments:

      • Reconstitute minimal systems with purified components in vitro

      • Gradually increase complexity to identify minimum components needed

      • Compare activity in cell-free extracts versus purified systems

    • Substrate Identification:

      • Use proteomics approaches to identify modified host proteins

      • Confirm direct modification using in vitro assays with purified components

      • Validate physiological relevance of modifications in infection models

  • Pathway Perturbation Analysis:

    • Genetic Epistasis Testing:

      • Knockdown putative direct targets and downstream components

      • Test if CBU_1818 effects persist when direct targets are absent

      • Create an epistasis map to position CBU_1818 within signaling cascades

    • Specific Inhibitors:

      • Use chemical inhibitors at defined points in affected pathways

      • Determine which CBU_1818 effects are blocked by specific inhibitors

      • Apply increasing inhibitor concentrations to test dose-dependence

    • Constitutively Active/Dominant Negative Approaches:

      • Express constitutively active forms of downstream effectors

      • Test if CBU_1818 effects are bypassed by pathway activation

      • Use dominant negative constructs to block specific nodes

  • Comparative Approaches:

    • CBU_1818 Variant Analysis:

      • Compare effects of wild-type and mutant CBU_1818 proteins

      • Identify mutations that selectively disrupt specific pathways

      • Correlate binding ability with pathway modulation

    • Cross-Species Comparison:

      • Compare CBU_1818 homologs from different Coxiella strains

      • Test orthologs from related bacteria if available

      • Identify conserved host targets across multiple bacterial effectors

  • Single-Cell Analysis:

    • Correlation Studies:

      • Measure CBU_1818 levels and pathway activities in individual cells

      • Calculate correlation coefficients between CBU_1818 and various pathway components

      • Identify threshold effects and non-linear relationships

    • Microenvironment Control:

      • Use microfluidic systems to precisely control cellular environment

      • Test how environmental factors influence CBU_1818 effects

      • Distinguish between direct CBU_1818 effects and environmental responses

  • Integrated Data Analysis:

    • Network Modeling:

      • Construct directed interaction networks from multiple data types

      • Apply causality algorithms to infer direct versus indirect effects

      • Use Bayesian approaches to assign probability scores to direct interactions

    • Validation Strategy:

      • Develop a multi-tier validation scheme requiring evidence from multiple approaches

      • Classify effects as "direct" only when supported by multiple independent methods

      • Maintain transparency about confidence levels for different interactions

This comprehensive approach enables researchers to confidently differentiate between the direct molecular targets of CBU_1818 and the downstream effects resulting from pathway perturbations, similar to successful approaches used with other C. burnetii effectors like CirB .

What are the potential applications of CBU_1818 research for developing therapeutics against Q fever?

Research on CBU_1818 could significantly impact therapeutic development for Q fever through multiple applications:

  • Direct Target-Based Drug Discovery:

    • If CBU_1818 proves essential for C. burnetii survival or virulence, inhibitors targeting this protein could serve as novel antibiotics. Similar approaches have been applied to other C. burnetii proteins, with in silico analysis revealing potential binding pockets for small molecule inhibitors .

    • Structure-based drug design could be employed once the three-dimensional structure of CBU_1818 is determined, allowing for rational design of specific inhibitors that disrupt its function without affecting host proteins.

    • High-throughput screening of chemical libraries against purified CBU_1818 could identify lead compounds for further development, similar to approaches used for other bacterial targets.

  • Host-Directed Therapeutics:

    • Understanding how CBU_1818 interacts with host cellular machinery could reveal opportunities for host-directed therapies. For example, if CBU_1818 manipulates specific host pathways, drugs that modulate these pathways might counteract the effects of CBU_1818 without directly targeting the bacterium.

    • Similar to how researchers discovered PSMB5 (proteasome subunit) as a target of another C. burnetii effector , identifying host proteins that interact with CBU_1818 could reveal new therapeutic targets.

    • This approach is particularly valuable for combating antibiotic resistance, as targeting host factors reduces selective pressure on the pathogen.

  • Vaccine Development:

    • Recombinant CBU_1818 could be evaluated as a component in subunit vaccines, either alone or in combination with other C. burnetii proteins. Previous studies have tested recombinant C. burnetii proteins as vaccine candidates, though with variable success .

    • If CBU_1818 proves to be antigenic (as observed with most recombinant C. burnetii proteins tested), it could elicit protective immune responses when properly formulated with appropriate adjuvants .

    • DNA vaccines encoding CBU_1818 could be developed to induce both humoral and cell-mediated immunity, potentially offering broader protection than protein-based approaches.

  • Diagnostic Applications:

    • If CBU_1818 is expressed during human infection and generates detectable antibody responses, it could serve as a biomarker for diagnostic tests. Recombinant CBU_1818 could be used in ELISA-based serological assays to detect anti-CBU_1818 antibodies in patient samples .

    • Monitoring responses to CBU_1818 and other C. burnetii proteins might help distinguish between acute and chronic Q fever infections or predict disease progression.

    • Multiplexed assays including CBU_1818 and other C. burnetii antigens could improve diagnostic sensitivity and specificity.

  • Virulence Inhibition Strategies:

    • If CBU_1818 functions as a virulence factor (similar to the effector CirB identified in C. burnetii ), targeting its delivery mechanism or activity could reduce pathogenicity without killing the bacterium, potentially reducing inflammation and tissue damage during treatment.

    • Peptide-based inhibitors that mimic interaction interfaces between CBU_1818 and its host targets could selectively block these interactions without affecting other cellular processes.

    • Small molecule screens to identify compounds that specifically disrupt CBU_1818 function could yield new classes of anti-virulence agents.

  • Therapeutic Monitoring:

    • Understanding CBU_1818's role in pathogenesis could provide new biomarkers to monitor treatment efficacy. Changes in CBU_1818 expression or activity during antibiotic therapy might serve as indicators of bacterial response to treatment.

    • This could be particularly valuable for chronic Q fever, where monitoring treatment effectiveness remains challenging.

  • Drug Delivery Systems:

    • If CBU_1818 is involved in host cell entry or intracellular trafficking, understanding these mechanisms could inspire new drug delivery approaches to target antibiotics to the intracellular compartments where C. burnetii resides.

    • Nanoparticles designed to mimic CBU_1818-mediated pathways could improve delivery of antibiotics to the Coxiella-containing vacuole.

The comprehensive understanding of CBU_1818's structure, function, and interactions with host cells provides multiple avenues for therapeutic innovation against Q fever, addressing the pressing need for more effective treatments for this globally significant pathogen .

What are the most promising future research directions for understanding the role of CBU_1818 in C. burnetii pathogenesis?

Future research on CBU_1818 should focus on several promising directions to elucidate its role in C. burnetii pathogenesis:

  • Comprehensive Functional Characterization:

    • Secretion Mechanism Verification: Determine if CBU_1818 is secreted through the Dot/Icm Type IV Secretion System, similar to other C. burnetii effectors . Using β-lactamase fusion assays would confirm its status as a translocated effector.

    • Temporal Expression Profiling: Establish when CBU_1818 is expressed during the infection cycle using high-resolution time-course studies to correlate expression with specific stages of pathogenesis.

    • Localization Studies: Track CBU_1818 localization within host cells using fluorescent protein fusions or specific antibodies to identify targeted host compartments or structures .

    • Knockout/Knockdown Phenotyping: Develop conditional expression systems or CRISPR-based approaches to modulate CBU_1818 levels and assess impact on bacterial replication, vacuole formation, and host response.

  • Structural Biology Approaches:

    • High-Resolution Structure Determination: Obtain crystal or cryo-EM structures of CBU_1818 to identify functional domains and potential active sites.

    • Structure-Function Correlations: Generate a library of point mutations based on structural data to identify critical residues for function.

    • Conformational Dynamics: Employ hydrogen-deuterium exchange mass spectrometry or FRET-based sensors to monitor structural changes in different environments.

    • Co-Crystal Structures: Determine structures of CBU_1818 in complex with host targets to elucidate molecular mechanisms of interaction.

  • Host-Pathogen Interaction Networks:

    • Systematic Interactome Mapping: Apply comprehensive protein-protein interaction screens to identify all host binding partners of CBU_1818 .

    • Dynamic Interactome Analysis: Track changes in the CBU_1818 interactome during different stages of infection to reveal temporal-specific functions.

    • Pathway Impact Assessment: Use phosphoproteomics and other signaling assays to determine which host signaling pathways are modulated by CBU_1818.

    • Comparative Analysis: Compare CBU_1818's interactions with those of other C. burnetii effectors to identify unique and overlapping functions within the effector repertoire.

  • Mechanistic Studies:

    • Enzymatic Activity Characterization: Test CBU_1818 for potential enzymatic activities (kinase, phosphatase, ubiquitin ligase, etc.) that might explain its effects on host cells.

    • Host Target Modification: Determine if CBU_1818 directly modifies host proteins through post-translational modifications, similar to how other bacterial effectors function.

    • Structural Mimicry: Investigate if CBU_1818 mimics host proteins to interfere with cellular processes, a common strategy among bacterial effectors.

    • Impact on Specific Cellular Processes: Examine effects on key processes like vesicular trafficking, immune signaling, cytoskeletal dynamics, and metabolic pathways.

  • Systems-Level Approaches:

    • Multi-Omics Integration: Combine transcriptomics, proteomics, and metabolomics data to build comprehensive models of CBU_1818's impact on host cells.

    • Single-Cell Analysis: Apply single-cell technologies to capture heterogeneity in host responses to CBU_1818.

    • Computational Modeling: Develop mathematical models of CBU_1818's role in infection to generate testable predictions about system behavior.

    • Network Analysis: Place CBU_1818 within the broader context of C. burnetii's virulence network to understand cooperative effects with other bacterial factors.

  • Translational Research Directions:

    • Immunogenicity Assessment: Evaluate CBU_1818 as a potential vaccine antigen, building on previous work with recombinant C. burnetii proteins .

    • Diagnostic Potential: Assess if anti-CBU_1818 antibodies are produced during human infection and could serve as diagnostic markers.

    • Drug Target Validation: Determine if CBU_1818 is essential for infection or virulence and thus a viable therapeutic target.

    • Small Molecule Screening: Identify compounds that disrupt CBU_1818 function or its interactions with host targets.

  • Evolutionary and Comparative Studies:

    • Strain Variation Analysis: Compare CBU_1818 sequences across C. burnetii isolates to identify conserved regions and polymorphisms associated with virulence.

    • Comparative Genomics: Analyze CBU_1818 homologs in related species to understand its evolutionary history and conservation of function.

    • Host Range Implications: Investigate if CBU_1818 contributes to C. burnetii's broad host range by interacting with conserved host factors.

    • Adaptation Signatures: Look for evidence of positive selection in CBU_1818 that might indicate adaptation to host defenses.

These research directions would significantly advance our understanding of CBU_1818's role in C. burnetii pathogenesis, potentially revealing new targets for therapeutic intervention and contributing to our broader knowledge of how intracellular pathogens manipulate host cells to establish successful infections.

What collaborative approaches and interdisciplinary methods would accelerate research on CBU_1818?

Accelerating research on CBU_1818 requires strategic interdisciplinary collaborations and innovative methodological approaches:

  • Core Disciplinary Collaborations:

    • Microbiology-Immunology Partnership: Combining expertise in C. burnetii biology with immunological methods to understand how CBU_1818 interfaces with host defense mechanisms.

    • Structural Biology-Biochemistry Integration: Merging structural determination techniques with functional biochemical assays to correlate structure with function.

    • Cell Biology-Systems Biology Synergy: Linking detailed cellular phenotypes with network-level analyses to place CBU_1818 in broader pathogenesis contexts.

    • Computational Biology-Experimental Biology Loop: Creating iterative cycles of computational prediction and experimental validation to efficiently explore CBU_1818 functions.

  • Advanced Technological Platforms:

    • High-Resolution Imaging Consortium: Establishing shared resources for advanced microscopy techniques:

      • Cryo-electron tomography to visualize CBU_1818 in native contexts

      • Super-resolution microscopy for precise localization studies

      • Live-cell imaging with single-molecule tracking

      • Correlative light and electron microscopy (CLEM) for structure-function integration

    • Multi-Omics Data Generation and Integration: Developing standardized protocols for:

      • Proteomics and interactomics specific to intracellular pathogens

      • Transcriptomics that can separate bacterial and host responses

      • Metabolomics to detect subtle changes in host metabolism

      • Computational pipelines to integrate these diverse data types

  • Innovative Methodological Approaches:

    • Microfluidic Infection Systems: Implementing devices for:

      • Precise control of infection parameters

      • Real-time monitoring of host-pathogen interactions

      • Single-cell analysis of heterogeneous responses

      • High-throughput screening of conditions

    • Genome Engineering Platforms: Adapting cutting-edge genetic tools for C. burnetii:

      • CRISPR-Cas systems optimized for intracellular pathogens

      • Inducible gene expression/repression systems

      • Site-specific recombination for precise genome modification

      • High-efficiency transformation protocols

  • Cross-Disciplinary Research Initiatives:

    • Physics-Biology Interface: Applying principles from:

      • Biophysical methods to study protein dynamics

      • Soft matter physics to understand membrane interactions

      • Nanoscale sensing for single-molecule detection

    • Chemistry-Biology Boundary: Implementing:

      • Chemical biology approaches for protein labeling

      • Click chemistry for tracking modified host proteins

      • Fragment-based drug discovery targeting CBU_1818

      • Chemical proteomics to identify direct targets

  • Clinical-Basic Science Partnerships:

    • Biobank Resources: Establishing repositories of:

      • Patient samples from Q fever cases

      • Clinical isolates with varying virulence

      • Host genetic information correlated with disease outcomes

    • Translational Research Pipeline: Creating frameworks for:

      • Rapid testing of CBU_1818-targeted interventions

      • Validation of diagnostic approaches

      • Clinical correlation of molecular findings

  • Collaborative Research Models:

    • Multi-Institution Research Networks: Organizing:

      • Distributed research teams with complementary expertise

      • Standardized protocols for data compatibility

      • Shared resources and technology platforms

      • Regular virtual and in-person collaboration events

    • Industry-Academia Partnerships: Fostering connections for:

      • Access to proprietary compound libraries

      • Development of therapeutic candidates

      • Scaling up production of recombinant proteins

      • Leveraging industry expertise in drug development

  • Data Science and Artificial Intelligence Integration:

    • Machine Learning Applications: Implementing ML for:

      • Predicting protein-protein interactions

      • Identifying functional domains from sequence data

      • Analyzing high-content imaging data

      • Accelerating structure prediction and drug design

    • Knowledge Management Systems: Developing platforms for:

      • Integration of heterogeneous data types

      • Visual analytics and interactive exploration

      • Automated hypothesis generation

      • Literature mining and knowledge extraction

  • Novel Animal Models and Alternatives:

    • Advanced Disease Models: Developing:

      • Humanized mouse models for improved relevance

      • Organ-on-chip systems mimicking human tissues

      • 3D cell culture systems recreating tissue architecture

      • Patient-derived organoids for personalized infection studies

  • Community Resource Development:

    • Open Science Infrastructure: Creating:

      • Repositories for CBU_1818-related data and reagents

      • Platforms for protocol sharing and optimization

      • Pre-registration frameworks for more robust studies

      • Open-access publication of all results

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.