Recombinant Crassostrea gigas Gigasin-6

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Gigasin-6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-302
Protein Length
Full Length of Mature Protein
Species
Crassostrea gigas (Pacific oyster) (Crassostrea angulata)
Target Protein Sequence
GPLEDRVRSTIQEVYKNCRKDKNPGVIVSVVKDGQNVLTEALGVKDKISGEAITTDTLFG LGGISALFANILIAKKNAEYAEMDEDTTLRNLFGNNKLFEKSKLRSRYATSLDVMAHRLG FKNTPHLFLDDTVTRGDPVIQRISSMKPRGRFRDSFYYNELTYSILTTIGERLGRDSWEN LVKNEIYTPLGMAKSKFFTTLDPSTVDIARAYKEDDGSLFPVPFEFLKKWSSLCSTTCVL SSANDMSKFMNYLLGQRKPSWTKPCVTGPRKFTLILFDAI
Uniprot No.

Target Background

Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Component of the organic matrix of calcified shell layers.

Q&A

What is Gigasin-6 and where is it found in Crassostrea gigas?

Gigasin-6 is a member of the gigasin family of proteins found in the Pacific oyster (Crassostrea gigas). It is primarily identified in the shell matrix space as a shell matrix protein (SMP). The protein is unique among the gigasin family due to its β-lactamase domain, which suggests potential protease functionality. Gigasin-6 is thought to be expressed in the mantle tissue of C. gigas and subsequently incorporated into the shell matrix during biomineralization processes .

Research indicates that proteins like Gigasin-6 can be isolated from the acid-insoluble matrix (AIM) and acid-soluble matrix (ASM) fractions of oyster shells. To confirm its precise localization, immunohistochemical techniques using antibodies raised against recombinant Gigasin-6 would be necessary, similar to approaches used for other oyster proteins such as defensins that are primarily expressed in the mantle edge .

How does Gigasin-6 differ from other proteins in the gigasin family?

Gigasin-6 is distinguished from other gigasin family proteins by its structural domains and potential functional properties. Out of the four identified gigasin family proteins in C. gigas, only Gigasin-6 contains a β-lactamase domain, which enables its classification as a protease according to previous research . This domain suggests that Gigasin-6 may represent an inactivated form of lactamase-related proteins while retaining protease functions.

Other gigasin family members (like Gigasin-4) lack this β-lactamase domain, indicating different evolutionary pathways and likely different functional roles within the oyster's biological systems. While all gigasins appear to be involved in shell formation processes, their specific contributions likely vary based on their unique structural characteristics.

What structural characteristics define recombinant Gigasin-6?

The recombinant form of Gigasin-6 should preserve the key structural elements of the native protein, particularly the β-lactamase domain that distinguishes it within the gigasin family. While comprehensive structural data specifically for Gigasin-6 is limited, domain prediction analysis using tools such as the Simple Modular Architecture Research Tool (SMART) confirms the presence of the β-lactamase domain .

When expressing recombinant Gigasin-6, researchers should consider the following structural features:

  • The presence and correct folding of the β-lactamase domain

  • Any disulfide bonding patterns that may be essential for structural integrity

  • Post-translational modifications that occur in the native protein

  • The correct tertiary structure that enables protease functionality

Domain analysis research suggests that protease domains including β-lactamase are structurally conserved across species, which can inform expression system selection and purification strategies for obtaining functional recombinant protein .

Why is recombinant expression of Gigasin-6 important for research?

Recombinant expression of Gigasin-6 is critical for research for several methodological and scientific reasons:

  • Isolation limitations: Natural extraction of Gigasin-6 from oyster shells yields minimal amounts, insufficient for comprehensive functional studies. Recombinant expression allows production of larger quantities.

  • Functional characterization: To definitively confirm protease activity and other hypothesized functions, purified protein in substantial quantities is required for enzymatic assays.

  • Structural studies: Recombinant protein can be used for structural determination through techniques like X-ray crystallography or NMR spectroscopy, similar to approaches used with oyster defensins .

  • Domain-specific analysis: Recombinant expression enables the creation of constructs with specific domains (like the β-lactamase domain) for isolated functional testing.

  • Mutation studies: Recombinant technologies facilitate site-directed mutagenesis to investigate the role of specific amino acid residues in Gigasin-6 function.

Following the successful approach used with oyster defensins, recombinant Gigasin-6 production in systems like Escherichia coli can provide material for antimicrobial activity testing, structural analyses, and investigation of potential roles in biomineralization .

What expression systems are suitable for recombinant Gigasin-6 production?

Several expression systems can be considered for recombinant Gigasin-6 production, each with distinct advantages for different research applications:

Bacterial Expression Systems (E. coli)

  • Most commonly used due to simplicity and cost-effectiveness

  • Suitable for initial characterization studies

  • Successfully employed for other C. gigas proteins like defensins

  • Limitations include lack of eukaryotic post-translational modifications and potential for inclusion body formation

Yeast Expression Systems (P. pastoris, S. cerevisiae)

  • Better for proteins requiring disulfide bond formation

  • Provides some post-translational modifications

  • Higher protein yield than mammalian systems

  • Preferable for proteins that may be toxic in bacterial systems

Insect Cell Lines (Sf9, High Five)

  • Closer to native eukaryotic processing

  • Good compromise between yield and proper folding

  • Suitable for proteins with complex disulfide bonding

Mammalian Cell Lines (CHO, HEK293)

  • Most comprehensive post-translational modifications

  • Ideal for functional studies requiring native-like protein

  • Lower yields and higher cost

  • Best choice when authenticity of modifications is critical

The choice should be guided by research objectives: E. coli systems work well for structural studies and initial characterization, while more complex eukaryotic systems may be necessary for functional studies requiring native-like modifications .

How can recombinant Gigasin-6 be purified effectively?

Effective purification of recombinant Gigasin-6 requires a strategic multi-step approach based on its physicochemical properties. The following methodology is recommended:

Initial Clarification

  • Cell lysis using appropriate buffer (e.g., phosphate buffer with protease inhibitors)

  • Centrifugation to remove cellular debris (typically 10,000-15,000 × g for 30 minutes)

  • Filtration through 0.45 μm filter to remove remaining particulates

Chromatographic Purification

  • Affinity Chromatography: Using fusion tags (His-tag, GST, etc.) for initial capture

    • His-tagged proteins can be purified using Ni-NTA or IMAC columns

    • Tag removal via precision protease cleavage site if necessary for functional studies

  • Ion Exchange Chromatography: Based on predicted isoelectric point

    • Anion exchange (if Gigasin-6 is negatively charged at working pH)

    • Cation exchange (if Gigasin-6 is positively charged at working pH)

  • Size Exclusion Chromatography: Final polishing step to separate aggregates and achieve high purity

    • Superdex 75 or 200 columns based on molecular weight

Quality Assessment

  • SDS-PAGE with Coomassie or silver staining to verify purity

  • Western blot with anti-Gigasin-6 antibodies to confirm identity

  • Mass spectrometry to verify integrity and post-translational modifications

For successful purification, analytical techniques similar to those used for shell matrix protein analysis would be applicable, including LC-MS/MS and Mascot/Scaffold software validation .

What challenges are commonly encountered in Gigasin-6 expression?

Researchers working with recombinant Gigasin-6 may face several technical challenges that require specific mitigation strategies:

ChallengeCauseMitigation Strategy
Poor solubilityHydrophobic regions, improper foldingUse solubility-enhancing fusion partners (SUMO, MBP, TRX); optimize buffer conditions with solubilizing agents
Low expression yieldCodon bias, toxicity to hostCodon optimization for expression host; use tightly regulated inducible promoters; culture at lower temperatures (16-20°C)
Proteolytic degradationHost proteases, intrinsic instabilityInclude protease inhibitor cocktails; use protease-deficient host strains; optimize extraction and purification timing
Incorrect disulfide bondingReducing environment in bacterial cytoplasmExpress in periplasm or use specialized E. coli strains (SHuffle, Origami); consider eukaryotic expression systems
Loss of activityImproper folding, missing cofactorsOptimize refolding protocols; supplement with potential cofactors during purification; express in eukaryotic systems

Similar challenges have been addressed in the recombinant expression of other molluscan proteins, such as defensins from C. gigas, where E. coli expression was optimized to retain antimicrobial activity . For Gigasin-6, special attention should be given to maintaining the functional integrity of the β-lactamase domain during expression and purification.

How can post-translational modifications be preserved in recombinant Gigasin-6?

Preserving post-translational modifications (PTMs) in recombinant Gigasin-6 is crucial for maintaining native functionality. While specific PTMs of Gigasin-6 are not fully characterized, strategies based on other shell matrix protein research can be applied:

  • Expression System Selection:

    • For glycosylation: Mammalian or insect cell systems provide more authentic glycosylation patterns than yeast or bacterial systems

    • For disulfide bonds: Yeast, insect, or mammalian cells, or specialized bacterial strains engineered for disulfide bond formation

  • Co-expression with Modifying Enzymes:

    • Introduce genes for relevant PTM enzymes into expression system

    • Example: Co-express glycosyltransferases in simpler expression systems

  • In vitro Modification:

    • Perform enzymatic modifications post-purification

    • Useful for specific modifications like phosphorylation or limited glycosylation

  • Analytical Verification:

    • Mass spectrometry methods similar to those used for shell matrix protein analysis

    • Glycan-specific staining and lectin blotting for glycosylation

    • NMR spectroscopy for structural confirmation, following approaches used for defensin analysis

For comprehensive PTM analysis of recombinant Gigasin-6, combined approaches of proteomics and glycomics would be necessary, similar to methodologies applied to other shell matrix proteins from C. gigas and related species .

What methods are used to characterize the protease activity of Gigasin-6?

The protease activity of recombinant Gigasin-6 can be characterized using multiple complementary methods:

Qualitative Screening Assays

  • Zymography: Incorporate substrates like casein or gelatin into SDS-PAGE gels to visualize proteolytic activity as clear zones after Coomassie staining

  • Agar plate diffusion assays: Apply protein samples to wells in substrate-containing agar and observe zones of substrate degradation

Quantitative Activity Assays

  • Fluorogenic substrates: Measure fluorescence release upon peptide cleavage using substrates with quenched fluorophores

  • Colorimetric assays: Monitor absorbance changes using chromogenic substrates like p-nitroanilide derivatives

  • FRET-based assays: Employ peptides with donor-acceptor fluorophore pairs to detect cleavage events through fluorescence changes

Kinetic Parameter Determination

  • Measure initial reaction rates at varying substrate concentrations

  • Calculate Km, Vmax, kcat values using Michaelis-Menten kinetics

  • Determine inhibition patterns using known protease inhibitors

Substrate Specificity Analysis

  • Peptide libraries: Screen against diverse peptide substrates to determine cleavage site preferences

  • Proteomic approaches: Identify natural substrates through mass spectrometry analysis of digestion products

Given that Gigasin-6 contains a β-lactamase domain but is classified as a protease, both protease and β-lactamase-specific assays should be performed to fully characterize its functional activity .

How can the β-lactamase domain functionality be assessed?

The β-lactamase domain of Gigasin-6 requires specific methodological approaches to characterize its functionality:

Classic β-Lactamase Activity Assays

  • Nitrocefin hydrolysis: Monitor the color change from yellow to red (λmax = 486 nm) when the β-lactam ring is hydrolyzed

  • Iodometric assay: Measure the decolorization of starch-iodine complex upon β-lactam hydrolysis

  • pH-stat titration: Detect proton release during β-lactam hydrolysis using pH indicators

Substrate Specificity Profiling

  • Test various β-lactam substrates, including:

    • Penicillins (ampicillin, penicillin G)

    • Cephalosporins (cephalothin, cefotaxime)

    • Carbapenems (imipenem, meropenem)

    • Monobactams (aztreonam)

Kinetic Analysis

  • Determine kinetic parameters (Km, kcat) for various substrates

  • Compare with known β-lactamases to classify functionality

  • Assess impact of environmental conditions (pH, salt concentration) on activity, particularly important for a marine organism protein

Inhibitor Studies

  • Test classic β-lactamase inhibitors (clavulanic acid, sulbactam, tazobactam)

  • Determine IC50 and Ki values

  • Establish inhibition mechanisms (competitive, noncompetitive)

The assessment should consider that Gigasin-6 is suggested to be an "inactivated form of lactamase-related proteins" , which may indicate altered or vestigial β-lactamase activity. Comparative analysis with standard β-lactamases would help determine the evolutionary and functional significance of this domain.

What assays are appropriate for testing Gigasin-6 antimicrobial properties?

Testing the potential antimicrobial properties of recombinant Gigasin-6 requires a comprehensive set of assays, drawing on approaches successfully applied to other C. gigas antimicrobial proteins:

In Vitro Growth Inhibition Assays

  • Broth microdilution: Determine minimum inhibitory concentration (MIC) against various microorganisms

  • Agar diffusion: Measure inhibition zones around protein-containing wells or discs

  • Time-kill kinetics: Monitor microbial death rates over time at different protein concentrations

  • Checkerboard assays: Test synergy with other antimicrobial agents

Mechanistic Studies

  • Membrane permeabilization assays: Using fluorescent dyes (propidium iodide, SYTOX Green)

  • Liposome leakage assays: Assess interaction with artificial membranes

  • Biofilm disruption assays: Test activity against established microbial biofilms

  • Cell morphology analysis: Observe structural changes via electron microscopy

Seawater-Specific Testing
Given that C. gigas is a marine organism, antimicrobial activity should be tested under conditions mimicking the oyster's natural environment:

  • Test activity at various salt concentrations (comparable to seawater)

  • Assess pH stability in the range of oceanic pH (7.5-8.4)

  • Evaluate temperature dependence relevant to marine environments

This approach would be similar to the methodology used for C. gigas defensin (Cg-Def), which was tested against gram-positive and gram-negative bacteria and fungi, with particular attention to activity retention in salt concentrations similar to seawater .

How does recombinant Gigasin-6 compare functionally to native protein?

Comparing recombinant Gigasin-6 to its native counterpart is essential for validating experimental findings. The following methodological approaches can be used to assess functional equivalence:

Structural Comparison

  • Circular dichroism (CD) spectroscopy: Compare secondary structure elements

  • Tryptophan fluorescence: Assess tertiary structure folding

  • Differential scanning calorimetry (DSC): Compare thermal stability profiles

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS): Evaluate oligomeric state

Post-translational Modification Analysis

  • Mass spectrometry: Compare mass profiles and identify modifications

  • Glycan analysis: If glycosylated, compare glycan patterns using lectin blots or mass spectrometry

  • Proteomic mapping: Compare peptide fragments after enzymatic digestion

Functional Equivalence Testing

  • Compare enzymatic parameters (Km, kcat, substrate specificity)

  • Assess relative activity under varying conditions (pH, temperature, salt)

  • Compare interactions with potential binding partners

  • Evaluate antimicrobial efficacy in identical assays

Immunological Recognition

  • Develop antibodies against native protein and test cross-reactivity

  • Compare epitope mapping profiles

A similar approach was used to validate recombinant Cg-Def (C. gigas defensin) against its native counterpart, demonstrating that the recombinant protein retained antimicrobial activity against gram-positive bacteria at salt concentrations similar to seawater .

How can recombinant Gigasin-6 contribute to shellfish immunity studies?

Recombinant Gigasin-6 offers valuable opportunities for investigating shellfish immunity through several advanced research applications:

Pathogen Challenge Models

  • Assess protection conferred by exogenous recombinant Gigasin-6 during pathogen challenges

  • Investigate synergistic effects with other immune effectors like defensins

  • Determine effective concentrations needed for pathogen control in controlled environments

Gene Expression Regulation

  • Study transcriptional changes of gigasin-6 during immune challenges

  • Compare expression patterns with other immune-related genes

  • Investigate whether gigasin-6 expression remains stable after bacterial challenge, similar to other C. gigas immune effectors like defensins

Receptor Binding and Signaling Studies

  • Identify potential pathogen-associated molecular patterns (PAMPs) recognized by Gigasin-6

  • Characterize binding mechanisms and downstream signaling cascades

  • Develop fluorescently-labeled recombinant Gigasin-6 for tracking interactions

Comparative Proteomics

  • Compare expression profiles between resistant and susceptible oyster populations

  • Identify potential polymorphisms affecting functionality

  • Determine if Gigasin-6 plays roles similar to other proteases in immune response pathways

Since Gigasin-6 contains a β-lactamase domain and could function as a protease, it may play roles in bacterial cell wall degradation or modification of immune signaling peptides. Research could explore whether it is continuously expressed in specific tissues, providing first-line defense against pathogens, similar to the constitutive expression pattern observed with Cg-def in oyster mantle tissue .

What techniques are used to study Gigasin-6 in biomineralization processes?

Investigating the role of Gigasin-6 in biomineralization requires specialized techniques that bridge molecular biology and materials science:

In Vitro Crystallization Studies

  • Crystal nucleation assays: Monitor calcium carbonate crystal formation in the presence of recombinant Gigasin-6

  • Polymorph selection analysis: Determine if Gigasin-6 influences aragonite vs. calcite formation

  • Real-time crystallization monitoring: Using techniques like dynamic light scattering or quartz crystal microbalance

Structural Analysis of Protein-Mineral Interactions

  • Cryo-electron microscopy: Visualize protein-mineral interfaces at near-atomic resolution

  • Atomic force microscopy: Study topographical changes during mineralization

  • Small-angle X-ray scattering (SAXS): Analyze protein conformation at mineral interfaces

Proteomic Approaches

  • In situ hybridization: Localize gigasin-6 expression in mantle tissue

  • Immunolocalization: Track protein distribution in shell layers

  • Protein-protein interaction studies: Identify binding partners in shell matrix

Functional Interference Studies

  • RNA interference: Suppress gigasin-6 expression and observe shell formation

  • CRISPR-Cas9 genome editing: Create gigasin-6 knockouts if applicable

  • Antibody blocking: Use anti-Gigasin-6 antibodies to inhibit function during shell repair

Comparative Analysis

  • Compare Gigasin-6 distribution across different shell regions

  • Analyze temporal expression during shell formation and repair

  • Conduct cross-species comparisons within bivalves

These approaches would build upon existing shell proteome research methodologies used to identify and characterize shell matrix proteins in C. gigas and other bivalves .

How might Gigasin-6 research inform evolutionary studies of molluscan proteins?

Gigasin-6 research offers unique opportunities to investigate evolutionary aspects of molluscan proteins, particularly those involved in shell formation and immunity:

Phylogenetic Analysis

  • Compare gigasin family sequences across molluscan species

  • Reconstruct evolutionary history of β-lactamase domain acquisition

  • Analyze selection pressures using Ka/Ks ratios to identify signatures of positive or purifying selection

Domain Evolution Studies

  • Investigate the evolutionary origin of the β-lactamase domain in Gigasin-6

  • Determine if this domain was acquired through horizontal gene transfer

  • Compare with bacterial β-lactamases to identify ancestral relationships

Functional Divergence Analysis

  • Assess conservation of catalytic residues across related proteins

  • Determine if Gigasin-6 represents neofunctionalization of an ancestral β-lactamase

  • Compare substrate specificities of Gigasin-6 with homologs from other species

Structural Comparative Analysis

  • Model Gigasin-6 structure based on related proteins

  • Compare structure-function relationships across mollusk lineages

  • Identify conserved structural motifs despite sequence divergence

Ecological Adaptation Analysis

  • Compare Gigasin-6 variants from oysters in different environmental niches

  • Correlate sequence or expression variations with environmental factors

  • Investigate how Gigasin-6 may have adapted to specific pathogens or mineralization requirements

This evolutionary framework would build upon existing phylogenetic approaches used in mollusk studies, such as those examining divergence times based on Bayesian analysis of mitochondrial genes .

What are the approaches for studying Gigasin-6 interactions with other shell matrix proteins?

Investigating how Gigasin-6 interacts with other shell matrix proteins requires a multi-faceted approach combining protein interaction studies with functional analysis:

Physical Interaction Analysis

  • Co-immunoprecipitation (Co-IP): Pull down Gigasin-6 complexes from shell extracts or recombinant mixtures

  • Yeast two-hybrid screening: Identify potential binding partners

  • Surface plasmon resonance (SPR): Measure binding kinetics and affinity constants

  • Microscale thermophoresis (MST): Detect interactions in solution with minimal sample consumption

Structural Interaction Characterization

  • Cross-linking mass spectrometry: Identify interaction interfaces at amino acid resolution

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Map protein-protein interaction surfaces

  • Small-angle X-ray scattering (SAXS): Analyze solution structures of protein complexes

  • Cryo-electron microscopy: Visualize complex structures at near-atomic resolution

Functional Interaction Studies

  • Calcium carbonate precipitation assays: Test effects of protein combinations on mineral formation

  • Enzyme activity modulation: Assess how other matrix proteins affect Gigasin-6 protease activity

  • In vitro reconstitution: Recreate minimal functional complexes from purified components

Computational Approaches

  • Molecular docking: Predict interaction interfaces between Gigasin-6 and other proteins

  • Molecular dynamics simulations: Model dynamic interactions in solution

  • Network analysis: Construct interaction maps from large-scale proteomics data

These methodologies would extend existing shell proteome research techniques, which have already identified multiple shell matrix proteins in C. gigas that could potentially interact with Gigasin-6 .

How can protein aggregation issues be addressed in Gigasin-6 research?

Protein aggregation is a common challenge in recombinant protein research that requires systematic troubleshooting:

Prevention Strategies

  • Expression optimization:

    • Lower induction temperature (16-20°C)

    • Reduce inducer concentration

    • Use slower expression systems with weaker promoters

  • Buffer optimization:

    • Screen various pH conditions (typically 6.5-8.5)

    • Test different salt concentrations (150-500 mM NaCl)

    • Include stabilizing additives (glycerol, sucrose, arginine)

    • Add mild detergents (0.05-0.1% Tween-20 or Triton X-100)

  • Co-expression approaches:

    • Express with chaperones (GroEL/ES, DnaK/J)

    • Co-express with protein disulfide isomerases for disulfide bond formation

Resolution Methods

  • Solubilization techniques:

    • Mild detergents for membrane-associated aggregates

    • Chaotropic agents at low concentrations (0.5-2 M urea)

    • Arginine hydrochloride (0.5-1 M) for reversible solubilization

  • Refolding strategies:

    • Dialysis-based stepwise removal of denaturants

    • On-column refolding during purification

    • Dilution methods with pulse refolding

Analytical Approaches

  • Aggregation monitoring:

    • Dynamic light scattering to detect early aggregation

    • Size exclusion chromatography to quantify aggregate formation

    • Analytical ultracentrifugation for detailed characterization

For Gigasin-6, considering its potential structural similarity to other shell matrix proteins and its β-lactamase domain, special attention should be given to maintaining proper disulfide bonding and domain folding during expression and purification .

What strategies help overcome low expression yields of recombinant Gigasin-6?

Addressing low expression yields requires a systematic optimization approach targeting multiple aspects of the recombinant protein production process:

Genetic Optimization

  • Codon optimization: Adjust codons to match expression host preferences

  • Vector selection: Test different promoters (T7, tac, AOX1) for optimal expression level

  • Fusion partners: Add solubility-enhancing tags (MBP, SUMO, TRX) that also improve expression

  • Signal sequence optimization: Modify for efficient secretion or periplasmic expression if applicable

Host System Selection and Modification

  • Strain engineering: Use strains with rare tRNA supplementation

  • Chaperone co-expression: Introduce folding helpers like GroEL/ES, trigger factor

  • Protease-deficient hosts: Select strains lacking key proteases (e.g., Lon, OmpT in E. coli)

  • Cell-free expression: Consider cell-free systems for toxic proteins

Culture Condition Optimization

  • Temperature modulation: Test reduced temperatures (16-25°C) to slow folding

  • Media optimization: Rich vs. minimal media, supplementation with amino acids

  • Induction parameters: Vary inducer concentration, induction timing, and duration

  • Feeding strategies: Implement fed-batch approaches to maintain growth rate

Scale-up Considerations

  • Bioreactor parameters: Optimize oxygen transfer, pH control, and feeding strategies

  • High-density cultivation: Implement protocols for achieving higher cell densities

  • Harvest timing optimization: Determine optimal harvest point for maximum yield

These approaches have been successfully applied to other challenging proteins from marine organisms, including antimicrobial peptides and enzymes with complex structures .

How can researchers resolve discrepancies between in vitro and in vivo findings?

Resolving discrepancies between in vitro and in vivo findings is crucial for accurate interpretation of Gigasin-6 function:

Methodological Reconciliation

  • Environmental condition matching: Adjust in vitro conditions to better mimic the oyster's natural environment

    • Test activity in artificial seawater

    • Incorporate physiologically relevant salt concentrations

    • Adjust pH to match shell matrix microenvironment

  • Multi-component systems: Reconstitute more complex systems in vitro

    • Include other shell matrix proteins that may be cofactors

    • Test in the presence of calcium carbonate substrates

    • Incorporate membrane components if relevant

Analytical Approaches

  • Sensitive in situ detection:

    • Develop antibodies for immunohistochemistry

    • Use activity-based probes for functional mapping

    • Implement CRISPR-Cas9 tagging for live visualization

  • Ex vivo approaches:

    • Develop mantle tissue explant cultures

    • Test shell repair models in laboratory conditions

    • Create microfluidic devices mimicking the shell matrix space

Validation Strategies

  • Genetic manipulation in vivo:

    • RNA interference to knock down expression

    • Overexpression studies to observe gain-of-function effects

    • CRISPR-Cas9 gene editing where feasible

  • Quantitative comparison:

    • Measure protein activity at physiologically relevant concentrations

    • Assess dose-response relationships in both systems

    • Compare kinetic parameters under varying conditions

For Gigasin-6, special attention should be given to the marine environment conditions. As observed with C. gigas defensin, activity can be retained at salt concentrations similar to seawater, which might be crucial for proper functional analysis .

What approaches help maintain biological activity of recombinant Gigasin-6?

Maintaining the biological activity of recombinant Gigasin-6 throughout production and storage requires specific strategies:

Production Phase Considerations

  • Expression system selection: Choose systems that facilitate proper folding and post-translational modifications

  • Cultivation conditions: Optimize temperature, pH, and media composition to enhance proper folding

  • Extraction methods: Use gentle cell disruption techniques to preserve protein structure

  • Purification approach: Design multi-step purification that minimizes exposure to harsh conditions

Buffer Optimization

  • pH optimization: Test range of pH values around physiological pH (typically 7.0-8.0 for marine organisms)

  • Salt concentration: Include appropriate levels of NaCl (considering marine environment)

  • Stabilizing additives:

    • Glycerol (10-20%) to prevent aggregation

    • Reducing agents (if necessary) for thiol protection

    • Protease inhibitors to prevent degradation

Storage and Handling

  • Storage temperature: Determine optimal conditions (-80°C, -20°C, 4°C)

  • Freeze-thaw stability: Test stability after multiple freeze-thaw cycles

  • Cryoprotectants: Include stabilizers for freezing (glycerol, trehalose)

  • Lyophilization potential: Assess activity retention after freeze-drying

Activity Monitoring

  • Regular activity assays: Implement standardized activity tests

  • Structural integrity checks: Use spectroscopic methods (CD, fluorescence) to monitor unfolding

  • Long-term stability studies: Monitor activity retention over time under various storage conditions

For Gigasin-6, considering its β-lactamase domain and potential protease activity, special attention should be given to maintaining the structural integrity of the catalytic site and ensuring that any disulfide bonds remain intact, similar to approaches used for defensin proteins from C. gigas .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.