Recombinant Cricetulus griseus 5-hydroxytryptamine receptor 1B (HTR1B)

Shipped with Ice Packs
In Stock

Description

Functional Characterization

HTR1B mediates serotonin (5-HT) signaling through G-protein coupling, primarily inhibiting adenylate cyclase activity and modulating downstream pathways like MAPK/ERK .

Key Functional Insights

  • Ligand Binding: Binds 5-HT, ergot alkaloids (e.g., methiothepin), and psychoactive drugs (e.g., LSD) .

  • Constitutive Activity: Exhibits basal Gαi3 subunit activation in the absence of agonists, modulated by NaCl concentration .

  • Agonist/Inverse Agonist Effects:

    • Agonists (e.g., 5-HT, alniditan): Stimulate Gαi3 activation .

    • Inverse Agonists (e.g., methiothepin, SB224,289): Inhibit constitutive Gαi3 activity .

Table 2: Functional Characteristics of HTR1B

PropertyDescriptionSource
G-Protein CouplingGi/o family, inhibits adenylate cyclase
Constitutive ActivityHigh-affinity [35S]GTPγS binding observed in basal conditions
NaCl SensitivityLower NaCl (10 mM) enhances basal activity and inverse agonist effects
MAPK/ERK ActivationStimulation via receptor activation in cell-based assays

Research Applications

HTR1B is critical for studying serotonin receptor pharmacology and drug development:

Experimental Methods

  • Luciferase Reporter Assays: Measures cAMP inhibition or MAPK/ERK activation .

  • [35S]GTPγS Binding: Quantifies G-protein activation (e.g., CHO cell membranes) .

  • Crystallography: Resolved structure with methiothepin reveals inverse agonist binding mechanics .

Case Studies

  • Avian HTR1B Cloning: Functional validation in chicken pituitaries confirmed conservation across vertebrates .

  • Cocaine-Seeking Behavior: 5-HT1B stimulation reduces cocaine-seeking in rodent models .

Clinical and Therapeutic Relevance

HTR1B is implicated in neuropsychiatric disorders and substance abuse:

Genetic Associations

  • Polymorphisms:

    • A-161T: Linked to alcohol dependence, affects promoter activity .

    • G861C: Associated with substance abuse and major depression .

Therapeutic Targets

  • Antidepressants: Selective serotonin reuptake inhibitors (SSRIs) may modulate HTR1B activity .

  • Migraine Therapies: Ergot alkaloids (e.g., sumatriptan) target HTR1B for vasoconstriction .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
HTR1B; 5-hydroxytryptamine receptor 1B; 5-HT-1B; 5-HT1B; Serotonin receptor 1B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-386
Protein Length
full length protein
Species
Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
Target Names
Target Protein Sequence
MEEQGIQCAPPPPAASQTGVPLVNLSHNCSAESHIYQDSIALPWKVLLVALLALITLATT LSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPVSTMYTVTGRWTLGQVVCDF WLSSDITCCTASIMHLCVIALDRYWAITDAVEYAAKRTPKRAAIMIALVWVFSISISLPP FFWRQAKAEEEVLTCLVNTDHVLYTVYSTGGAFYLPTLLLIALYGRIYVEARSRILKQTP NKTGKRLTRAQLITDSPGSTTSVTSINSRAPDLPSESGSPVYVNQVKVRVSDALLEKKKL MAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHMATLDFFNWLGYLNSLI NPIIYTMSNEDFKQAFHKLIRFKCAG
Uniprot No.

Target Background

Function
This G-protein coupled receptor, known as the 5-hydroxytryptamine (serotonin) receptor 1B (HTR1B), binds to 5-hydroxytryptamine (serotonin) and various alkaloids and psychoactive substances. Ligand binding triggers a conformational change, initiating signaling via guanine nucleotide-binding proteins (G proteins) and modulating the activity of downstream effectors, such as adenylate cyclase. This signaling process inhibits adenylate cyclase activity. Arrestin family members regulate G protein signaling and mediate activation of alternative signaling pathways. HTR1B plays a role in regulating the release of 5-hydroxytryptamine, dopamine, and acetylcholine in the brain, thereby affecting neural activity, nociceptive processing, pain perception, mood, and behavior. Furthermore, it contributes to vasoconstriction of cerebral arteries.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is recombinant Cricetulus griseus 5-hydroxytryptamine receptor 1B and how is it typically expressed?

Recombinant Cricetulus griseus 5-hydroxytryptamine receptor 1B (HTR1B) refers to the serotonin 1B receptor that has been genetically engineered for expression in laboratory systems, typically using Chinese hamster ovary (CHO) cells. This G-protein-coupled receptor (GPCR) is commonly studied in heterologous expression systems to examine its pharmacological properties and signaling mechanisms. The receptor is typically expressed by transfecting receptor DNA constructs into CHO cells, which provide a mammalian cellular environment for proper protein folding and post-translational modifications. Expression in CHO cells allows researchers to study receptor-ligand interactions and downstream signaling pathways in a controlled system without interference from other serotonergic receptor subtypes that might be present in native tissues .

How do polymorphisms in the HTR1B gene affect receptor function?

HTR1B polymorphisms have been extensively studied for their effects on receptor function and association with various conditions including major depressive disorder (MDD) and suicidal behavior. The rs6296 polymorphism has been shown to be significantly associated with increased risk of MDD, with carriers of the GC and GC/CC genotypes having 1.26-fold and 1.22-fold increased risk, respectively. Similarly, the rs6298 CT genotype has been associated with a 1.48-fold increased risk of suicidal behavior .

Functional studies have demonstrated that these polymorphisms can alter receptor expression and signaling properties. The 3′ region of HTR1B has been shown to have a regulatory effect on gene expression, with variations at rs6297 (A/G) demonstrating an inhibitory effect on gene expression in experimental models .

What cell lines are most appropriate for HTR1B recombinant expression studies?

Multiple cell lines have been employed for HTR1B recombinant expression studies, each offering specific advantages:

Cell LineOriginAdvantagesCommon Applications
CHOChinese hamster ovaryLow endogenous GPCR expression, high transfection efficiencyPharmacological characterization, binding assays
SK-N-SHHuman neuroblastomaNeuronal background, endogenous signaling machineryFunctional studies, neuronal context
HEK-293Human embryonic kidneyEasy to transfect, rapid growthHigh-throughput screening, initial characterization
U87Human glioblastomaGlial background, relevant for CNS studiesBrain-specific signaling studies

Studies have shown that the regulatory effects of HTR1B gene regions can vary between cell lines. For example, changes in relative fluorescence intensities between certain truncated HTR1B fragments were observed only in SK-N-SH cells, while other fragments showed differences across multiple cell lines . This cell-type specificity should be considered when designing expression systems for HTR1B studies.

How do in vitro observations of HTR1B inverse agonism translate to in vivo systems?

Studies have shown that while SB224,289 markedly suppresses [35S]-GTP gamma S binding in heterologous CHO expression systems, in quantitative autoradiographical studies of brain tissues (substantia nigra and caudate nucleus), SB224,289 and S18127 cannot be distinguished in terms of their modulation of [35S]-GTP gamma S binding. Both compounds block the action of 5-HT1B agonists without modifying binding on their own .

Furthermore, in functional in vivo studies measuring serotonin release in rat frontal cortex or body temperature regulation, the inverse agonist SB224,289 and neutral antagonist S18127 produced indistinguishable effects. These findings suggest that constitutive activity of HTR1B receptors, which is the basis for detecting inverse agonism, may be less prominent in native tissues than in recombinant systems. This discrepancy highlights the importance of validating in vitro findings with appropriate in vivo models .

What are the methodological approaches for identifying functional regions in the HTR1B gene?

Researchers have employed several sophisticated approaches to identify functional regions within the HTR1B gene, particularly focusing on the 3' region which has regulatory effects on gene expression:

  • Truncated Fragment Analysis: This approach involves creating a series of truncated sequence recombinants covering different portions of the 3' region. These constructs are then transfected into various cell lines (such as SK-N-SH, HEK-293, and U87), and changes in relative fluorescence intensities between fragments are measured to identify regions with regulatory functions .

  • Haplotype Recombinant Construction: This method analyzes different naturally occurring genetic variants (haplotypes) to determine their functional consequences. DNA samples containing different haplotypes (H1 to H7) can be used as templates for amplification, with the target fragments typically including the whole 3' UTR. These fragments are then cloned into reporter vectors such as pmirGLO for functional assessment .

  • MicroRNA Prediction and Validation: Computational tools like TarBase can be used to predict microRNAs that might target HTR1B. Candidates such as hsa-miR-21-3p, hsa-miR-941, and hsa-miR-129-2-3p have been identified through high-throughput experimental methods and can be further validated for their regulatory effects on HTR1B expression .

What are the optimal experimental protocols for measuring HTR1B signaling in recombinant systems?

Optimal experimental protocols for measuring HTR1B signaling in recombinant systems typically focus on G-protein activation and downstream signaling pathways. The [35S]-GTP gamma S binding assay is considered a gold standard for directly measuring G-protein activation:

[35S]-GTP gamma S Binding Protocol:

  • Prepare membrane fractions from HTR1B-expressing cells (typically CHO cells)

  • Incubate membranes with [35S]-GTP gamma S in the presence of test compounds

  • Terminate reaction by rapid filtration

  • Measure bound radioactivity by scintillation counting

This assay can distinguish between agonists (which increase binding), partial agonists (which moderately increase binding), neutral antagonists (which have no effect alone but block agonist responses), and inverse agonists (which decrease basal binding) .

For functional studies of HTR1B signaling, additional approaches include:

  • cAMP Assays: Since HTR1B couples to Gi/o proteins, activation leads to inhibition of adenylyl cyclase and reduced cAMP levels. This can be measured using various commercially available kits or FRET-based sensors.

  • Calcium Flux Assays: Though not directly coupled to calcium signaling, HTR1B activity can be assessed through chimeric G-protein constructs or promiscuous G-proteins that redirect signaling to calcium mobilization.

  • ERK Phosphorylation: HTR1B activation leads to ERK phosphorylation, which can be quantified by western blotting or cell-based ELISA methods.

When designing these experiments, it's critical to include appropriate controls such as known agonists (e.g., GR46611, CP93129), partial agonists (e.g., GR127,935), neutral antagonists (e.g., S18127), and inverse agonists (e.g., SB224,289) .

How should researchers address contradictory findings in HTR1B genetic association studies?

Contradictory findings are common in HTR1B genetic association studies, as evidenced by meta-analyses showing inconsistent results across individual studies. To address these contradictions, researchers should consider the following methodological approaches:

  • Conduct Properly Powered Studies: Many individual studies lack sufficient sample size. Statistical power calculations should be performed using tools such as Quanto software to ensure adequate power (>80%) for detecting genetic effects .

  • Standardize Phenotype Definitions: Variability in defining outcomes (e.g., treatment response, remission criteria) contributes to contradictory findings. Standardized definitions should be established and adhered to across studies .

  • Account for Ethnic Differences: Subgroup analyses by ethnicity are essential as HTR1B polymorphism effects may vary between populations. The inconsistent findings between Asian, Caucasian, and mixed populations highlight the importance of considering ethnic background .

  • Implement Rigorous Quality Control: Detailed information about matching criteria between cases and controls and quality control for genotyping assays should be reported .

  • Meta-Analysis Approach: When individual studies show contradictory results, meta-analysis can provide more reliable estimates by increasing statistical power. This approach has successfully identified significant associations between rs6296 and MDD risk, as well as rs6298 and suicidal behavior risk that were not consistently detected in individual studies .

  • Consider Gene-Environment Interactions: Environmental factors may modify genetic effects, leading to contradictory findings when not accounted for in the analysis.

What experimental controls are essential for validating HTR1B expression and function in recombinant systems?

Proper experimental controls are crucial for validating HTR1B expression and function in recombinant systems. The following controls should be implemented:

For Expression Validation:

  • Empty Vector Control: Cells transfected with expression vector lacking the HTR1B insert to control for vector-related effects

  • Transfection Efficiency Control: Co-transfection with a reporter gene (e.g., GFP) to normalize for transfection efficiency

  • Quantitative PCR: Verification of mRNA expression levels

  • Western Blot or Flow Cytometry: Confirmation of protein expression using validated antibodies

  • Radioligand Binding: Determination of receptor density (Bmax) and binding affinity (Kd) using selective ligands

For Functional Validation:

  • Positive Controls: Include known HTR1B agonists such as GR46611 or CP93129 to confirm receptor functionality

  • Reference Compounds: Compare results with compounds of known efficacy profiles (full agonists, partial agonists, neutral antagonists, and inverse agonists)

  • Dose-Response Curves: Generate complete dose-response relationships rather than single-concentration data

  • Signal Transduction Controls: Include forskolin (for cAMP assays) or ionomycin (for calcium assays) as positive controls for signaling pathway integrity

  • Specificity Controls: Demonstrate that effects can be blocked by selective HTR1B antagonists

  • Cell Line Authentication: Regular authentication of the cell line used for expression to prevent cross-contamination issues

Implementing these controls helps ensure that observed effects are genuinely attributable to HTR1B function rather than experimental artifacts or non-specific effects.

How can researchers effectively interpret HTR1B functional data across different cell lines?

The interpretation of HTR1B functional data across different cell lines requires careful consideration of cellular context and methodological consistency. Studies examining the 3' region of HTR1B have shown that regulatory effects can vary significantly between cell lines such as SK-N-SH (neuronal), HEK-293 (kidney-derived), and U87 (glial) .

To effectively interpret such data:

What are the methodological considerations for studying truncated HTR1B variants?

The study of truncated HTR1B variants requires specific methodological considerations to ensure meaningful results:

  • Precise Design of Truncated Constructs: When creating truncated sequence recombinants, careful attention should be paid to ensuring that truncations maintain the reading frame and do not disrupt critical structural elements of the receptor. Studies have successfully employed truncated fragments designated as D0 through D7, with each fragment designed to isolate specific functional regions .

  • Selection of Appropriate Reporter Systems: Truncated fragments should be cloned into suitable reporter vectors (e.g., pmirGLO) that allow sensitive detection of expression differences. The reporter system should include internal controls for normalization .

  • Sequential Truncation Approach: A systematic approach involving sequential truncations allows identification of specific regulatory regions. Comparing relative fluorescence intensities between fragments of different lengths (e.g., D4 versus D5, D6 versus D7) can reveal regions with significant regulatory effects .

  • Multi-Cell Line Validation: Testing truncated constructs in multiple cell lines (SK-N-SH, HEK-293, U87) is essential for identifying cell-type specific effects versus general regulatory mechanisms. Regions showing consistent effects across all cell types, such as the sequences +2440 to +2769 bp and +1953 to +2311 bp in the HTR1B 3' region, are particularly significant .

  • Functional Correlation: Correlate expression data from truncated constructs with functional assays to determine whether changes in expression translate to alterations in receptor signaling capacity.

  • Consideration of RNA Structure: Truncations may alter RNA secondary structure, potentially affecting regulatory interactions independent of the primary sequence. Computational prediction of RNA structure changes should be considered when interpreting results.

What emerging techniques might enhance our understanding of HTR1B function in recombinant systems?

Several emerging techniques offer promising approaches to deepen our understanding of HTR1B function in recombinant systems:

  • CRISPR-Cas9 Genome Editing: This technology allows precise modification of the HTR1B gene in its native chromatin context, enabling studies of endogenous receptor regulation without overexpression artifacts. Introduction of specific polymorphisms (e.g., rs6296, rs6298) into isogenic cell lines would allow direct assessment of their functional consequences.

  • Bioluminescence Resonance Energy Transfer (BRET) and FRET-Based Biosensors: These approaches enable real-time monitoring of receptor conformational changes, interactions with signaling partners, and downstream signaling events in living cells. Development of HTR1B-specific biosensors would allow dynamic assessment of receptor activation states.

  • Single-Cell Analysis: Application of single-cell transcriptomics and proteomics to HTR1B-expressing cells could reveal cell-to-cell variability in receptor expression and signaling, providing insights into the heterogeneity of receptor function that is masked in population-based studies.

  • Cryo-Electron Microscopy (Cryo-EM): This technique could potentially reveal the three-dimensional structure of HTR1B in different conformational states, providing unprecedented insights into the structural basis of agonist, antagonist, and inverse agonist actions.

  • Spatial Transcriptomics: This approach could map the expression patterns of HTR1B and its regulatory elements with high spatial resolution, providing context for understanding tissue-specific regulation.

  • Integrative Multi-Omics Approaches: Combining genomic, transcriptomic, proteomic, and metabolomic data from HTR1B-expressing systems could provide a comprehensive view of receptor function and its impact on cellular physiology.

How might future meta-analyses improve our understanding of HTR1B pharmacogenetics?

Future meta-analyses could significantly enhance our understanding of HTR1B pharmacogenetics through several methodological improvements:

These advancements would address current limitations in HTR1B pharmacogenetic research and potentially lead to more actionable insights for personalized treatment approaches in conditions like major depressive disorder.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.