Recombinant Cricetulus griseus Apoptosis regulator Bcl-2 (BCL2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Cricetulus griseus Apoptosis Regulator Bcl-2 (BCL2)

Recombinant Cricetulus griseus Apoptosis Regulator Bcl-2 (BCL2) refers to a genetically engineered version of the BCL2 protein derived from the Chinese hamster (Cricetulus griseus). BCL2 is a key regulator of apoptosis, or programmed cell death, and plays a crucial role in maintaining cellular homeostasis and preventing cancer. The recombinant form of this protein is often used in research and biotechnology applications to study apoptosis mechanisms and develop therapeutic strategies for diseases related to dysregulated apoptosis.

Background on BCL2 Proteins

BCL2 proteins are part of a larger family that includes both pro-apoptotic and anti-apoptotic members. The BCL2 protein itself is anti-apoptotic, meaning it inhibits cell death by preventing the release of cytochrome C from mitochondria, thereby blocking the activation of caspases that execute apoptosis . This function is critical in maintaining tissue homeostasis and preventing excessive cell loss.

Role of BCL2 in Apoptosis Regulation

BCL2 regulates apoptosis primarily by interacting with other members of the BCL2 family. It binds to pro-apoptotic proteins like BAX and BAK, preventing them from forming pores in the mitochondrial outer membrane, which is a crucial step in initiating apoptosis . The balance between pro-survival and pro-apoptotic BCL2 family members determines whether a cell will undergo apoptosis.

Recombinant BCL2 Applications

Recombinant BCL2 proteins, such as those derived from Cricetulus griseus, are used in various research applications:

  • ELISA Kits: These proteins are often used in enzyme-linked immunosorbent assay (ELISA) kits to detect and quantify BCL2 levels in samples. This is important for studying apoptosis in different cell types and disease states .

  • Cancer Research: Overexpression of BCL2 is associated with several cancers, making it a target for therapeutic interventions. Recombinant BCL2 can be used to study these mechanisms and develop inhibitors .

  • Cell Culture Studies: Recombinant BCL2 can be used to modulate apoptosis in cell culture systems, allowing researchers to study the effects of altered BCL2 expression on cell survival and death.

Table 1: BCL2 Family Members and Their Functions

ProteinFunctionLocation
BCL2Anti-apoptoticMitochondria, ER
BCL-XLAnti-apoptoticMitochondria
BAXPro-apoptoticMitochondria
BAKPro-apoptoticMitochondria
BIMPro-apoptotic (BH3-only)Cytoplasm
PUMAPro-apoptotic (BH3-only)Cytoplasm

Table 2: Applications of Recombinant BCL2

ApplicationDescription
ELISA KitsDetection and quantification of BCL2 in samples
Cancer ResearchStudying BCL2 overexpression and developing inhibitors
Cell CultureModulating apoptosis in cell culture systems

References Frontiers in Oncology. (2022). The role of BCL-2 family proteins in regulating apoptosis and cancer. Applied BioLabs. ELISA Recombinant Cricetulus griseus Apoptosis regulator Bcl-2. Wikipedia. Bcl-2. Nature Reviews Molecular Cell Biology. (2013). Control of apoptosis by the BCL-2 protein family. PubMed Central. (2013). Multiple Functions of BCL-2 Family Proteins. Nature Reviews Cancer. (2018). Regulation of apoptosis in health and disease: the balancing act of the BCL-2 protein family. Journal of Cell Science. Expanding roles of BCL-2 proteins in apoptosis execution and beyond. Hindawi. (2012). The Role of BCL2 Family of Apoptosis Regulator Proteins in Acute Lymphoblastic Leukemia.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
BCL2; Apoptosis regulator Bcl-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-236
Protein Length
full length protein
Species
Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
Target Names
Target Protein Sequence
MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDVGDVDAAPLGAAPTPGIFSFQPESNPTPA VHRDMAARTSPLRPIVATTGPTLSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTP FTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNR HLHTWIQDNGGWDAFVELYGPSVRPLFDFSWLSLKTLLSLALVGACITLGTYLGHK
Uniprot No.

Target Background

Function

This recombinant Cricetulus griseus Apoptosis regulator Bcl-2 (BCL2) protein suppresses apoptosis in various cell systems, including factor-dependent lymphohematopoietic and neural cells. It regulates cell death by modulating mitochondrial membrane permeability and functions within a feedback loop with caspases. BCL2 inhibits caspase activity by preventing cytochrome c release from mitochondria and/or binding to apoptosis-activating factor 1 (APAF-1). Furthermore, it acts as an autophagy inhibitor, interacting with BECN1 and AMBRA1 under non-starvation conditions to suppress their autophagy function. It may also attenuate inflammation by hindering NLRP1-inflammasome activation, thereby reducing CASP1 activation and IL1B release.

Protein Families
Bcl-2 family
Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein. Nucleus membrane; Single-pass membrane protein. Endoplasmic reticulum membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.