Recombinant Cricetulus griseus ATP synthase subunit a (MT-ATP6)

What is ATP synthase subunit a (MT-ATP6) and what is its role in mitochondrial function?

ATP synthase subunit a, encoded by the mitochondrial MT-ATP6 gene, is an essential component of the F₀ sector of mitochondrial ATP synthase (Complex V). This subunit is situated in the inner mitochondrial membrane and forms part of the proton channel. It works with the c-ring to create the pathway through which protons move from the intermembrane space into the mitochondrial matrix, driven by the proton electrochemical gradient. This proton movement powers the rotation of the c-ring, which is mechanically coupled to the F₁ sector, ultimately enabling ATP synthesis from ADP and inorganic phosphate .

The interface between subunit a and the c-ring constitutes the classic proton-translocating pathway in the F₀ sector. This interaction is crucial for maintaining the proton-motive force that drives ATP synthesis. Without functional subunit a, the proton channel cannot operate correctly, leading to impaired ATP production and potentially severe energetic deficiencies in cells .

How does recombinant Cricetulus griseus MT-ATP6 differ from human MT-ATP6?

The amino acid sequence provided for the recombinant protein (MNENLFSSFITPTLMGLPIIILIIMFPPVIMTSSKRLVNNRFHTFQQWLIKLITKQMMAIHSPKGRTWSLMLASLIIFIGSTNLLGLLPHTFTPTTQLSMNLGMAIPPWAGAVILGFRHKMKDSLAHFLPQGTPIPLIPMLVIIETISLFIQPMALAVRLTANITAGHLLMHLIGGATLVLTSISLPTAMITFIILIMLTILEFAVALIQAYVFTLLVSLYLHDNT) shows the highly hydrophobic nature of this membrane protein, consisting of multiple transmembrane domains that anchor it within the inner mitochondrial membrane . These structural features are conserved between species but with subtle variations that may affect protein-protein interactions or functional properties in experimental systems.

What experimental models are suitable for studying MT-ATP6 function?

Cell culture models using either Cricetulus griseus cells (CHO cells) or human cell lines with modified MT-ATP6 expression offer insights into physiological roles and pathological mechanisms. When studying MT-ATP6 in cellular contexts, researchers should consider mitochondrial isolation techniques and membrane protein extraction methods that preserve the native structure and interactions of the protein .

For more complex physiological studies, yeast models have proven valuable due to the high conservation of ATP synthase assembly and function across eukaryotes. Yeast models allow for genetic manipulations that would be challenging in mammalian systems while retaining the fundamental aspects of ATP synthase biology .

What expression systems are most effective for producing functional recombinant MT-ATP6?

For functional studies, eukaryotic expression systems such as yeast (Saccharomyces cerevisiae or Pichia pastoris), insect cells (using baculovirus expression systems), or mammalian cell lines may be preferable. These systems provide more appropriate cellular machinery for proper folding and assembly of mitochondrial membrane proteins. Specifically, yeast expression systems have been extensively used for studying ATP synthase components due to the well-characterized assembly process of complex V in yeast .

When expressing highly hydrophobic membrane proteins like MT-ATP6, modifications may be necessary to enhance expression and solubility. These can include:

• Using fusion tags beyond the His-tag (such as MBP or SUMO)

• Codon optimization for the expression host

• Co-expression with chaperones to aid proper folding

• Expression at lower temperatures to reduce inclusion body formation

What are the optimal conditions for solubilizing and purifying recombinant MT-ATP6?

Solubilizing and purifying recombinant MT-ATP6 presents significant challenges due to its hydrophobic nature and multiple transmembrane domains. Based on established protocols for similar mitochondrial membrane proteins, the following methodological approach is recommended:

• Cell lysis and membrane fraction isolation:

  • Gentle lysis methods using osmotic shock or mild detergents

  • Differential centrifugation to isolate membrane fractions

  • Washing steps to remove peripheral membrane proteins

• Membrane protein solubilization:

  • Use of appropriate detergents such as n-dodecyl-β-D-maltoside (DDM), digitonin, or Triton X-100

  • Optimization of detergent concentration is crucial (typically 0.5-2%)

  • Inclusion of stabilizing agents such as glycerol (5-20%)

  • Maintenance of physiological pH (7.2-8.0) using Tris or phosphate buffer systems

• Affinity purification:

  • For His-tagged recombinant MT-ATP6, nickel or cobalt affinity chromatography

  • Use of detergent in all purification buffers to maintain solubility

  • Gradual elution with imidazole to separate weakly bound contaminants

• Post-purification handling:

  • Storage in buffer containing 6% trehalose as a stabilizing agent

  • Aliquoting and storage at -20°C/-80°C to prevent repeated freeze-thaw cycles

  • Reconstitution to 0.1-1.0 mg/mL in deionized sterile water with 5-50% glycerol for long-term storage

How can researchers verify the proper folding and functionality of purified recombinant MT-ATP6?

Verifying proper folding and functionality of purified recombinant MT-ATP6 requires multiple complementary approaches:

• Structural integrity assessment:

  • Circular dichroism (CD) spectroscopy to analyze secondary structure composition

  • Limited proteolysis to evaluate the compactness of protein folding

  • Size-exclusion chromatography to assess aggregation state

• Functional assays:

  • Reconstitution into liposomes or nanodiscs to create a membrane environment

  • Proton conductance assays to assess channel functionality

  • ATP synthesis assays when reconstituted with other ATP synthase components

  • Binding assays with known interaction partners (e.g., other F₀ subunits)

• Integration into ATP synthase complex:

  • Assembly assays using native PAGE or clear native PAGE (CN-PAGE)

  • Complementation studies in cell lines with MT-ATP6 deficiency

  • Co-immunoprecipitation with other known complex V components

When interpreting functionality data, researchers should consider that isolated MT-ATP6 may not exhibit full functionality without the context of the complete ATP synthase complex, as its primary role involves interactions with the c-ring and other F₀ subunits in the proton translocation process .

What are the critical structural features of MT-ATP6 that influence ATP synthase function?

MT-ATP6 contains several critical structural features that directly influence ATP synthase function:

• Transmembrane helices: The protein contains multiple transmembrane domains that anchor it within the inner mitochondrial membrane. These helices are arranged to form part of the proton channel in the F₀ sector .

• Proton half-channel: MT-ATP6 forms a half-channel structure that guides protons from the intermembrane space to the crucial arginine residue in the c-ring. This structure is essential for the directional movement of protons .

• Interface with c-ring: The interface between subunit a and the c-ring is critical for proton translocation. Specific residues at this interface facilitate proton movement to the c-ring, driving its rotation .

• Interaction domains with other subunits: MT-ATP6 also contains regions that interact with other F₀ components, particularly subunit A6L, which provides a physical link between the proton channel and other subunits of the peripheral stalk .

The highly conserved hydrophobic regions in the MT-ATP6 sequence (MNENLFSSFITPTLMGLPIIILIIMFPPVIMTSSKRLVNNRFHTFQQWLIKLITKQMMAIHSPKGRTWSLMLASLIIFIGSTNLLGLLPHTFTPTTQLSMNLGMAIPPWAGAVILGFRHKMKDSLAHFLPQGTPIPLIPMLVIIETISLFIQPMALAVRLTANITAGHLLMHLIGGATLVLTSISLPTAMITFIILIMLTILEFAVALIQAYVFTLLVSLYLHDNT) reflect these structural features .

How does MT-ATP6 contribute to the di- and oligomerization of ATP synthase?

MT-ATP6 plays a significant role in the di- and oligomerization of ATP synthase, which has important implications for both enzymatic efficiency and mitochondrial morphology:

• Interface formation: MT-ATP6 contributes to the interface between adjacent ATP synthase monomers, particularly through interactions with subunit e, g, and k, which are crucial for dimer formation .

• Membrane curvature induction: The dimerization of ATP synthase, facilitated by MT-ATP6 and other subunits, creates an angular association between monomers. This angular arrangement induces curvature in the inner mitochondrial membrane, contributing to the formation of cristae structures .

• Stabilization of dimer ribbons: MT-ATP6 helps stabilize dimer ribbons of ATP synthase that shape the inner mitochondrial membrane. These dimer ribbons are typically found at the apex of cristae, where they generate strong local positive curvature .

• Proton trap formation: The membrane curvature created by ATP synthase dimers and oligomers, with MT-ATP6 as a contributing component, helps form a proton trap at cristae tips. This local concentration of protons enhances the efficiency of ATP synthesis .

Research indicates that the proper arrangement of ATP synthase dimers and oligomers, which depends partly on MT-ATP6, is not only crucial for optimal enzymatic activity but also for maintaining proper mitochondrial morphology and function .

What experimental approaches can reveal the dynamic interactions between MT-ATP6 and other ATP synthase components?

Several sophisticated experimental approaches can reveal the dynamic interactions between MT-ATP6 and other ATP synthase components:

• Cryo-electron microscopy (cryo-EM):

  • Allows visualization of ATP synthase complexes in different conformational states

  • Can reveal structural arrangements of MT-ATP6 relative to other subunits

  • Provides insights into rotational states and subunit interactions

• Cross-linking mass spectrometry (XL-MS):

  • Identifies interaction points between MT-ATP6 and adjacent subunits

  • Can capture transient interactions during the catalytic cycle

  • Helps map the topology of subunit arrangements

• Förster resonance energy transfer (FRET):

  • Measures distances between fluorescently labeled components

  • Can track dynamic changes during ATP synthesis or hydrolysis

  • Provides real-time information about conformational changes

• Native mass spectrometry:

  • Analyzes intact membrane protein complexes

  • Determines subunit stoichiometry and stability of subcomplexes

  • Identifies stable interactions that survive ionization

• Single-molecule techniques:

  • Directly observe rotation of F₁F₀ ATP synthase components

  • Measure rotational torque and stepping behavior

  • Correlate proton movement with mechanical rotation

• Molecular dynamics simulations:

  • Model interactions between MT-ATP6 and other subunits

  • Simulate proton movement through the MT-ATP6/c-ring interface

  • Predict conformational changes during the catalytic cycle

By combining these approaches, researchers can develop a comprehensive understanding of how MT-ATP6 dynamically interacts with other components during the proton translocation and ATP synthesis processes .

How can recombinant MT-ATP6 be used to study mitochondrial disease mechanisms?

Recombinant MT-ATP6 provides valuable research tools for investigating mitochondrial disease mechanisms through several methodological approaches:

• Structure-function studies of disease-associated mutations:

  • Site-directed mutagenesis to introduce known pathogenic mutations

  • Functional assays to measure the impact on proton translocation

  • Structural analysis to determine how mutations affect protein folding or interactions

• Protein-protein interaction studies:

  • Pull-down assays using wild-type versus mutant MT-ATP6 to identify differential binding partners

  • Analysis of assembly intermediates in the presence of mutant MT-ATP6

  • Identification of factors that might rescue mutant phenotypes

• Cell-based disease models:

  • Transfection of mutant MT-ATP6 variants into cell lines

  • Measurement of ATP synthesis rates and mitochondrial membrane potential

  • Assessment of mitochondrial morphology and cristae structure

  • Evaluation of cellular consequences such as ROS production and apoptosis

• Therapeutic development platforms:

  • Screening for compounds that stabilize mutant MT-ATP6

  • Identification of molecules that enhance residual ATP synthase activity

  • Development of peptide-based approaches to rescue assembly defects

• Immunological tools:

  • Generation of antibodies against specific MT-ATP6 epitopes

  • Development of tools to quantify MT-ATP6 levels in patient samples

  • Creation of immunohistochemistry methods for tissue analysis

These applications can provide insights into diseases associated with MT-ATP6 mutations, such as neuropathy, ataxia, retinitis pigmentosa (NARP), and maternally inherited Leigh syndrome (MILS) .

What model systems are most appropriate for integrating recombinant MT-ATP6 in functional studies?

The integration of recombinant MT-ATP6 in functional studies requires careful selection of appropriate model systems based on the specific research questions:

• Reconstituted proteoliposomes:

  • Ideal for biophysical studies of proton translocation

  • Allow precise control of lipid composition and protein stoichiometry

  • Enable measurement of proton pumping or ATP synthesis activities

  • Methodology involves purification of recombinant MT-ATP6, solubilization in detergent, and reconstitution with phospholipids through detergent removal

• Submitochondrial particles (SMPs):

  • Inside-out vesicles derived from mitochondria

  • Suitable for studying ATP synthesis or hydrolysis

  • Allow access to the F₁ domain for direct activity measurements

  • Can be prepared from cells expressing recombinant MT-ATP6

• MT-ATP6-deficient cell lines complemented with recombinant protein:

  • Enable assessment of MT-ATP6 variants in a cellular context

  • Allow measurement of mitochondrial function parameters

  • Suitable for studying assembly of ATP synthase complex

  • Methods include cybrid cell technology or CRISPR/Cas9-mediated editing

• Yeast expression systems:

  • Well-established genetics and mitochondrial isolation techniques

  • Homologous recombination allows precise gene replacement

  • Viable ATP synthase mutants due to fermentative growth capacity

  • Allows functional complementation studies with Cricetulus griseus MT-ATP6

• Cell-free expression systems:

  • Direct incorporation into nanodiscs or liposomes

  • Avoids complications of cellular targeting and import

  • Useful for rapid screening of multiple variants

  • Can be coupled with functional assays for immediate testing

When selecting a model system, researchers should consider the trade-off between physiological relevance and experimental control, choosing the system that best answers their specific research questions while accounting for technical feasibility.

How can researchers use recombinant MT-ATP6 to investigate the assembly process of ATP synthase?

Recombinant MT-ATP6 provides a valuable tool for investigating the complex assembly process of ATP synthase through several methodological approaches:

• Assembly intermediate analysis:

  • Expression of tagged recombinant MT-ATP6 in cells lacking endogenous protein

  • Isolation of assembly intermediates using tag-based purification

  • Analysis of composition by mass spectrometry or western blotting

  • Visualization of intermediates using clear native PAGE (CN-PAGE), which uses milder detergents than blue native PAGE (BN-PAGE)

• Assembly factor identification:

  • Affinity purification of recombinant MT-ATP6 during various stages of assembly

  • Identification of transiently interacting assembly factors

  • Validation through knockdown or knockout studies

  • Investigation of assembly factor binding sites on MT-ATP6

• Kinetic studies of assembly:

  • Pulse-chase experiments with inducible expression of recombinant MT-ATP6

  • Time-course analysis of incorporation into subcomplexes and mature complex V

  • Determination of rate-limiting steps in assembly

  • Effects of stress conditions or inhibitors on assembly kinetics

• Structure-function analysis in assembly:

  • Mutagenesis of key residues in MT-ATP6

  • Assessment of effects on various stages of assembly

  • Correlation between structural features and assembly competence

  • Identification of domains critical for interactions with other subunits

Based on current understanding, MT-ATP6 is incorporated at a late stage in the assembly process, after the formation of the F₁-c-ring subcomplex and attachment of the peripheral stalk. In human mitochondria lacking mtDNA (and therefore subunits a and A6L), ATP synthase can assemble into a complex with a mass of 550 kDa, slightly smaller than the complete holocomplex (597 kDa) . This suggests that MT-ATP6 and A6L are among the final components added during assembly, consistent with the proposed assembly sequence in which the c-ring forms first, followed by binding of F₁, the stator arm, and finally subunits a and A6L .

What are the common pitfalls in working with recombinant MT-ATP6 and how can they be addressed?

Working with recombinant MT-ATP6 presents several challenges due to its hydrophobic nature and mitochondrial origin. Common pitfalls and their solutions include:

• Poor expression yield:

  • Problem: Highly hydrophobic membrane proteins often express poorly.

  • Solutions:

    • Use specialized E. coli strains designed for membrane proteins

    • Optimize growth temperature (typically lower temperatures improve folding)

    • Consider fusion partners that enhance solubility (MBP, SUMO)

    • Explore alternative expression systems (yeast, insect cells)

• Protein aggregation:

  • Problem: MT-ATP6 may form inclusion bodies or aggregate during purification.

  • Solutions:

    • Optimize detergent type and concentration (DDM, LMNG, or digitonin)

    • Include stabilizing agents such as trehalose (6%) or glycerol (5-50%)

    • Maintain cold temperatures throughout purification

    • Consider amphipol or nanodisc reconstitution for increased stability

• Loss of structural integrity:

  • Problem: Isolation from native environment may disrupt protein structure.

  • Solutions:

    • Avoid repeated freeze-thaw cycles

    • Store at -80°C in small aliquots

    • Include lipids during purification to maintain native-like environment

    • Validate structural integrity using CD spectroscopy or limited proteolysis

• Contamination with other proteins:

  • Problem: Non-specific binding to purification resins.

  • Solutions:

    • Optimize imidazole concentrations in wash buffers

    • Consider tandem purification strategies (His-tag plus secondary tag)

    • Use size exclusion chromatography as a final purification step

    • Validate purity using SDS-PAGE and mass spectrometry

• Loss of functional activity:

  • Problem: Isolated MT-ATP6 may not retain native functionality.

  • Solutions:

    • Reconstitute with other ATP synthase components

    • Verify activity in proteoliposome systems

    • Optimize lipid composition to mimic mitochondrial inner membrane

    • Consider co-expression with interacting partners

How can researchers optimize the storage and handling of recombinant MT-ATP6 to maintain stability?

Optimizing storage and handling conditions is crucial for maintaining the stability and activity of recombinant MT-ATP6:

• Initial preparation:

  • Centrifuge vials briefly before opening to bring contents to the bottom

  • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (preferably 50%) for long-term storage

• Storage conditions:

  • Store at -20°C/-80°C for long-term preservation

  • Prepare small working aliquots to avoid repeated freeze-thaw cycles

  • For short-term use (up to one week), store working aliquots at 4°C

• Buffer composition:

  • Maintain in Tris/PBS-based buffer with 6% trehalose at pH 8.0

  • Include appropriate detergent at concentrations above critical micelle concentration

  • Consider adding reducing agents (DTT or TCEP) to prevent oxidation of cysteine residues

  • Protease inhibitors may help prevent degradation during storage

• Handling practices:

  • Always maintain the cold chain during experimental procedures

  • Use low-protein-binding tubes and pipette tips

  • Centrifuge briefly after thawing to collect condensation

  • Monitor protein stability over time using analytical techniques (e.g., SEC, SDS-PAGE)

• Alternative stabilization approaches:

  • Consider lyophilization with appropriate cryoprotectants for very long-term storage

  • Explore nanodiscs or amphipol systems for enhanced stability

  • Evaluate chemical stabilizers specific for membrane proteins

Proper storage and handling significantly impact experimental reproducibility and reliability when working with challenging membrane proteins like MT-ATP6.

What quality control measures should be implemented to ensure the integrity of recombinant MT-ATP6 in experimental settings?

Rigorous quality control measures are essential for ensuring the integrity of recombinant MT-ATP6 in experimental settings:

• Pre-experimental validation:

  • Purity assessment: SDS-PAGE with Coomassie or silver staining (should exceed 90% purity)

  • Identity confirmation: Western blot with specific antibodies and/or mass spectrometry peptide analysis

  • Sequence verification: N-terminal sequencing or mass spectrometry to confirm proper translation

  • Tag functionality: Verification that the His-tag is accessible and functional

• Structural integrity assessment:

  • Secondary structure analysis: Circular dichroism (CD) spectroscopy to confirm alpha-helical content

  • Thermal stability: Differential scanning fluorimetry or CD thermal melt

  • Aggregation state: Size exclusion chromatography or dynamic light scattering

  • Membrane insertion: Protease protection assays after liposome reconstitution

• Functional validation:

  • Binding assays: Interaction with known protein partners (other ATP synthase subunits)

  • Activity assays: Proton translocation in reconstituted systems

  • Assembly competence: Incorporation into ATP synthase subcomplexes

  • Complementation assays: Rescue of MT-ATP6-deficient systems

• Batch-to-batch consistency:

  • Standard operating procedures: Detailed protocols for expression and purification

  • Reference standards: Retention of reference samples from validated batches

  • Comparative analysis: Side-by-side testing of new batches against reference material

  • Documentation: Comprehensive record-keeping of all production parameters

• Storage stability monitoring:

  • Time-course analysis: Regular testing of stored material to establish stability profiles

  • Accelerated stability: Predictive testing under stressed conditions

  • Activity retention: Functional assays at defined time points

  • Degradation products: Regular checks for proteolytic fragments

Implementation of these quality control measures will ensure experimental reproducibility and reliability when working with recombinant MT-ATP6, particularly important given its challenging biochemical properties as a hydrophobic membrane protein.