Recombinant Cricetulus griseus Gap junction gamma-1 protein (GJC1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them in your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag if feasible.
Synonyms
GJC1; GJA7; Gap junction gamma-1 protein; Connexin-45; Cx45; Gap junction alpha-7 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-396
Protein Length
full length protein
Species
Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
Target Names
GJC1
Target Protein Sequence
MSWSFLTRLLEEIHNHSTFVGKIWLTVLIVFRIVLTAVGGESIYYDEQSKFVCNTEQPGC ENVCYDAFAPLSHVRFWVFQIILVATPSVMYLGYAIHKIAKMEHGEADKKAARSKPYAMR WKQHRALEETEEDHEEDPMMYPEMELESEKENKEQSQPKPKHDGRRRIREDGLMKIYVLQ LLARTVFEVGFLIGQYFLYGFQVHPFYVCSRLPCPHKIDCFISRPTEKTIFLLIMYGVTG LCLLLNIWEMLHLGFGTIRDSLNSKRRELDDPGAYNYPFTWNTPSAPPGYNIAVKPDQIQ YTELSNAKIAYKQNKANIAQEQQYGSHEEHLPADLETLQREIRMAQERLDLAIQAYHHQN NPHGPREKKAKVGSKSGSNKSSISSKSGDGKTSVWI
Uniprot No.

Target Background

Function
Gap junctions are clusters of closely packed pairs of transmembrane channels, known as connexons. These connexons facilitate the diffusion of low molecular weight materials between adjacent cells.
Database Links
Protein Families
Connexin family, Gamma-type subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

What is Gap Junction Gamma-1 Protein (GJC1) and what is its role in cellular communication?

GJC1, also known as Connexin-45 (Cx45) or previously labeled as Gap Junction Alpha-7 protein (GJA7), belongs to the connexin family, specifically the gamma-type subfamily. This protein is a fundamental component of gap junctions, which are specialized intercellular structures. Each gap junction consists of a cluster of closely packed pairs of transmembrane channels called connexons, which facilitate the direct diffusion of low molecular weight materials between adjacent cells .

The primary function of GJC1 is to establish direct intercellular communication pathways. These channels allow passive diffusion of molecules up to 1 kDa, including essential nutrients, metabolites (such as glucose), ions (K+, Ca2+), and second messengers (IP3, cAMP) . This communication is critical for coordinated cellular activities, tissue homeostasis, and various physiological processes.

How does GJC1 differ from other connexin family members?

GJC1 is specifically classified within the gamma-type subfamily of connexins, distinguishing it from other connexin types such as the beta family (which includes GJB4) . Each connexin subtype has unique properties regarding:

  • Channel conductance and permeability

  • Voltage sensitivity

  • Regulation by post-translational modifications

  • Tissue-specific expression patterns

  • Compatibility with other connexins in forming heterotypic channels

Unlike GJA1 (Connexin-43), which is expressed constitutively in many tissues including normal cardiac tissue, GJC1 shows more restricted expression patterns. Importantly, connexin expression patterns can change under pathological conditions, as evidenced by studies of cardiac tissue where altered expression of specific connexins correlates with disease states .

What expression systems are recommended for producing recombinant Cricetulus griseus GJC1?

For successful expression of recombinant Cricetulus griseus GJC1, researchers should consider the following expression systems based on experimental requirements:

Expression SystemAdvantagesChallengesRecommended Applications
E. coliCost-effective, high yield, rapid productionLimited post-translational modifications, potential inclusion body formationStructural studies, antibody production
Mammalian cells (CHO, HEK293)Native-like post-translational modifications, proper foldingHigher cost, longer production timeFunctional studies, interaction studies
Insect cells (Sf9, Hi5)Higher yield than mammalian cells, some post-translational modificationsGlycosylation patterns differ from mammalian cellsStructural biology, large-scale production
Cell-free systemsRapid production, easily modified conditionsLimited yield, higher costQuick screening, labeled protein production

When expressing transmembrane proteins like GJC1, mammalian expression systems (particularly CHO cells derived from Cricetulus griseus) often provide advantages for proper folding and membrane insertion . Tag selection should be carefully considered as it may affect protein function or localization.

What are effective strategies for functional characterization of recombinant GJC1?

To assess the functionality of recombinant GJC1, researchers should implement multiple complementary approaches:

  • Electrophysiological techniques: Patch-clamp recordings to measure channel conductance properties in cell pairs or reconstituted systems.

  • Dye transfer assays: Using gap-junction permeable dyes (like Lucifer Yellow) to assess intercellular communication in cells expressing recombinant GJC1.

  • Fluorescence Recovery After Photobleaching (FRAP): To measure the rate of gap junction-mediated communication between adjacent cells.

  • Immunocytochemistry and co-localization studies: To verify proper trafficking and localization to cell-cell contact points, similar to how GJA1 and GJB4 colocalization has been studied in cardiac tissue .

  • Co-immunoprecipitation: To identify protein-protein interactions with other gap junction components or regulatory proteins.

The methodological approach should include both protein characterization (Western blotting, mass spectrometry) and functional assessment to ensure that the recombinant protein properly mimics the native protein's properties.

How should researchers optimize storage conditions for recombinant GJC1?

Effective storage of recombinant GJC1 is critical for maintaining protein integrity and functionality. Based on established protocols for similar membrane proteins:

  • Short-term storage (1-2 weeks): Store at 4°C in appropriate buffer with 50% glycerol as indicated in product information .

  • Long-term storage: Store at -20°C or preferably -80°C in single-use aliquots to avoid freeze-thaw cycles .

  • Buffer composition: Tris-based buffers with stabilizing agents (glycerol at approximately 50%) have been shown to be effective .

  • Avoid repeated freeze-thaw cycles as they can lead to protein denaturation and loss of function .

Testing protein functionality after various storage periods is recommended to establish the optimal storage duration for your specific experimental purposes.

What methods are most effective for studying GJC1 interactions with other connexins in gap junction formation?

To investigate the interactions between GJC1 and other connexins in gap junction formation, researchers should consider these methodological approaches:

  • Proximity Ligation Assays (PLA): This technique can detect protein-protein interactions with high specificity and sensitivity in situ.

  • FRET/BRET Analysis: Fluorescence or bioluminescence resonance energy transfer can reveal close associations between differentially labeled connexins.

  • Super-resolution microscopy: Techniques such as STORM or PALM can visualize the nanoscale organization of connexins within gap junction plaques.

  • Co-expression systems: Similar to studies that have examined colocalization of GJA1 with GJB4 in cardiac tissue , researchers can co-express GJC1 with other connexins to study heteromeric or heterotypic channel formation.

  • Electrophysiological characterization: Measure conductance and permeability properties of channels formed by GJC1 alone versus those formed by combinations of connexins.

These approaches can provide complementary information about the structural and functional aspects of GJC1 interactions in gap junction assembly.

How can researchers effectively investigate the role of GJC1 in disease models?

To study GJC1's role in disease processes, researchers should consider these methodological approaches:

  • Gene silencing or knockout models: Using siRNA, CRISPR-Cas9, or conditional knockout models to assess the effects of GJC1 deficiency.

  • Disease-specific expression analysis: Similar to studies that have shown differential expression of connexins in cardiac disease , researchers should analyze GJC1 expression patterns in relevant disease models.

  • Mutation studies: Introduce disease-associated mutations into GJC1 and assess their effects on protein trafficking, gap junction formation, and channel properties.

  • Transgenic animal models: Develop models with altered GJC1 expression or function to study systemic effects.

  • Pharmacological modulation: Use gap junction blockers or enhancers to modulate GJC1 function and assess the impact on disease progression.

What techniques are most suitable for studying post-translational modifications of GJC1?

Post-translational modifications (PTMs) significantly impact connexin trafficking, assembly, and function. For studying PTMs of GJC1, consider these methods:

  • Mass spectrometry-based approaches:

    • Shotgun proteomics for global PTM identification

    • Targeted MS methods for quantifying specific modifications

    • Top-down proteomics for analyzing intact protein forms

  • Site-directed mutagenesis: To study the functional impact of specific modification sites by mutating target residues.

  • Phospho-specific antibodies: For detecting and quantifying phosphorylation events at specific sites.

  • Pulse-chase experiments: To study the dynamics of PTMs throughout the protein's lifecycle.

  • In vitro enzymatic assays: To identify enzymes responsible for specific modifications.

When planning these experiments, researchers should consider both constitutive PTMs that regulate normal function and those that change during pathological conditions, potentially altering gap junction communication.

What are common challenges in recombinant GJC1 expression and how can they be addressed?

ChallengePossible CausesSolutions
Low expression yieldProtein toxicity, inefficient codon usage, complex membrane proteinUse inducible expression systems, optimize codons for host, use specialized membrane protein expression hosts
Inclusion body formationRapid expression rate, improper foldingLower induction temperature, use fusion tags (SUMO, MBP), co-express chaperones
Proteolytic degradationExposure to proteases during purificationInclude protease inhibitors, optimize purification speed, use protease-deficient strains
Poor membrane integrationInadequate membrane insertion machineryUse eukaryotic expression systems for membrane proteins, optimize signal sequences
Non-functional proteinImproper folding, missing PTMsVerify protein folding using circular dichroism, consider mammalian expression systems

When troubleshooting, implement a systematic approach by changing one variable at a time and documenting all adjustments to experimental conditions.

How should researchers interpret apparent contradictions in GJC1 functional data?

When confronted with contradictory results in GJC1 research:

  • Consider model system differences: Results from different cell types or organisms may vary due to differing cellular contexts. For example, the expression patterns of gap junction proteins can differ significantly between species and tissues, as seen in the varying expression of GJB4 between normal and diseased cardiac tissues .

  • Evaluate methodology variations: Different functional assays (electrophysiology vs. dye transfer) may measure different aspects of gap junction function.

  • Examine protein expression levels: Over-expression may lead to artifacts not representative of physiological function.

  • Assess potential interactions with endogenous proteins: Endogenous connexins may form heteromeric channels with recombinant GJC1, altering functional properties.

  • Analyze post-translational modification status: Different PTM patterns can significantly alter connexin function.

To resolve contradictions, researchers should design experiments that directly compare conditions using identical methodologies and include appropriate controls to isolate variables.

What criteria should be used to validate antibody specificity for GJC1 detection?

Ensuring antibody specificity is critical for accurate GJC1 research. Validation should include:

  • Positive and negative controls:

    • Expression systems with and without GJC1

    • Tissues/cells known to express or lack GJC1

    • Knock-down or knock-out models

  • Cross-reactivity testing:

    • Test against related connexins (particularly other gamma-type connexins)

    • Peptide competition assays

  • Multiple detection methods:

    • Confirm results using antibodies targeting different epitopes

    • Correlate with mRNA expression data

    • Verify with tagged recombinant proteins

  • Proper experimental controls:

    • Secondary antibody-only controls

    • Isotype controls

    • Pre-immune serum controls

Documentation of antibody validation should be maintained and reported in publications to ensure reproducibility and reliability of research findings.

What are promising approaches for studying GJC1 regulation in real-time?

Emerging technologies for real-time investigation of GJC1 regulation include:

  • Optogenetic approaches: Light-controlled systems for modulating GJC1 expression or function with high temporal resolution.

  • CRISPR activation/repression systems: For precise temporal control of endogenous GJC1 expression.

  • Live-cell imaging with fluorescent protein fusions: To track GJC1 trafficking, assembly, and turnover in real-time.

  • Genetically encoded sensors: For measuring gap junction-mediated communication events in living cells.

  • Single-molecule tracking: To follow individual GJC1 molecules during gap junction assembly and remodeling.

These approaches can provide unprecedented insights into dynamic regulation of GJC1 at different stages of the protein's lifecycle and under varying physiological conditions.

How can computational approaches enhance understanding of GJC1 structure-function relationships?

Computational methods offer valuable tools for GJC1 research:

  • Homology modeling: Using the known structures of other connexins to predict GJC1's structure, particularly important given the challenges in obtaining crystal structures of membrane proteins.

  • Molecular dynamics simulations: To examine channel properties, ion selectivity, and conformational changes during gating.

  • Systems biology approaches: To integrate GJC1 into broader signaling networks and predict functional impacts of perturbations.

  • Machine learning algorithms: For predicting protein-protein interactions and regulatory mechanisms.

  • Structural bioinformatics: To identify conserved functional domains and predict the impact of mutations.

These computational approaches can guide experimental design and help interpret experimental results within a broader structural and functional context.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.