Recombinant Cricetulus griseus Mannose-P-dolichol utilization defect 1 protein (MPDU1)

Shipped with Ice Packs
In Stock

Description

Recombinant Cricetulus griseus Mannose-P-dolichol utilization defect 1 protein (MPDU1): Overview

The Recombinant Cricetulus griseus MPDU1 protein is a synthetic version of the endogenous mannose-P-dolichol utilization defect 1 protein, encoded by the MPDU1 gene. This multi-transmembrane protein plays a critical role in glycosylation by facilitating the utilization of mannose-phosphate-dolichol (Man-P-Dol) and glucose-phosphate-dolichol (Glc-P-Dol) substrates for lipid-linked oligosaccharide biosynthesis in the endoplasmic reticulum (ER) . Defects in MPDU1 are linked to congenital disorders of glycosylation type 1f (CDG-If), characterized by systemic dysfunctions such as psychomotor retardation, seizures, and hepatic abnormalities .

Key Features

AttributeDetails
Gene NameMPDU1 (aliases: SL15, CDGIF, Lec35, PQLC5)
Host OrganismsCricetulus griseus (Chinese hamster), engineered in E. coli, yeast, baculovirus, or mammalian cells
Purity≥85% (determined by SDS-PAGE)
ApplicationsRNA interference (RNAi), Western blot, ELISA, immunohistochemistry (IHC)

Functional Significance

MPDU1 is essential for:

  1. Glycosylation Substrate Utilization: Enables the use of Man-P-Dol and Glc-P-Dol in the assembly of lipid-linked oligosaccharides, precursors for N-linked glycosylation, O-mannosylation, and GPI anchor biosynthesis .

  2. Disease Pathogenesis: Mutations (e.g., L74S) disrupt oligosaccharide precursor maturation, leading to truncated intermediates and impaired glycosylation .

Disease Association

DisorderClinical Features
CDG-IfSevere psychomotor retardation, seizures, hepatopathy, skin abnormalities
DystroglycanopathyHypotonia, elevated creatine kinase, cardiomyopathy, congenital glaucoma

Production Methods

Recombinant MPDU1 is synthesized in heterologous systems, including:

Host SystemProtein LengthPurityTag Information
E. coliPartial≥85% (SDS-PAGE)Tag type varies
Yeast/BaculovirusPartial≥85% (SDS-PAGE)No tag specified
Mammalian cellsFull-length≥85% (SDS-PAGE)Affinity tags

Applications in Research

ApplicationPurposeExample Use
RNA InterferenceTo study MPDU1 gene silencing effects in glycosylation pathways CDG-If modeling
Western BlotDetection of MPDU1 expression in cell lysates Protein validation
ELISAQuantification of MPDU1 levels in biological fluids Diagnostic assays

Protein Architecture

MPDU1 belongs to the PQ-loop family, characterized by:

  • 7 transmembrane helices (7TM structure).

  • Conserved proline-glutamine (PQ) motifs in extracellular loops .

  • Lack of intrinsic enzymatic activity, suggesting a regulatory or trafficking role .

Functional Studies

  1. Complementation Assays: Transfection of wild-type MPDU1 restores normal glycosylation in Lec35 mutant cells, whereas mutant alleles (e.g., L74S) fail to rescue defects .

  2. Glycosylation Deficits: MPDU1-deficient fibroblasts accumulate truncated lipid-linked oligosaccharides (e.g., Man5GlcNAc2) due to impaired substrate utilization .

Therapeutic Potential

  • Gene Therapy: Retroviral delivery of functional MPDU1 restores glycosylation in CDG-If patient cells .

  • Biomarker Development: MPDU1 levels in serum/plasma may aid in diagnosing CDG-If .

Challenges

  • Protein Stability: MPDU1 requires storage at -20°C/-80°C for long-term viability .

  • Partial vs. Full-Length: Partial recombinant proteins may lack critical functional domains .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order and we will fulfill them as requested.
Lead Time
Delivery times may vary based on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is required, please inform us in advance as an additional fee will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a final concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
MPDU1; Mannose-P-dolichol utilization defect 1 protein; Suppressor of Lec15 and Lec35 glycosylation mutation; SL15
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-247
Protein Length
Full Length of Mature Protein
Species
Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
Target Names
MPDU1
Target Protein Sequence
AGEADGPFKRVLVPVLLPEKCYDQLFVHWDFLHVPCLKILLSKGLGLGIVAGSLLVKLPQ IFKILGAKSAEGLSLQSVMLELVALTGTVIYSITNNFPFSSWGEALFLTLQTITICLLVL HYRGDTVKGVALLACYATLLLALLSPLTPLAVVTMLQASNVPAVVVGKLLQAATNYHNGH TGQLSAITVFMLFGGSLARIFTSVQETGDPLMAGVFVVSSLCNGLIAAQVLFYWNAKPPH KHKKEQ
Uniprot No.

Target Background

Function
MPDU1 is crucial for the normal utilization of mannose-dolichol phosphate (Dol-P-Man) in the synthesis of N-linked and O-linked oligosaccharides and GPI anchors.
Database Links
Protein Families
MPDU1 (TC 2.A.43.3) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of MPDU1 protein in glycosylation pathways?

MPDU1 (Mannose-Phosphate-Dolichol Utilization Defect 1) plays a critical role in the utilization of dolichol-phosphate-mannose (DPM), which serves as the mannose donor for both N-glycosylation and O-mannosylation pathways. The protein, also known as Suppressor of Lec15 and Lec35 glycosylation mutation (SL15), facilitates the flipping of mannose-containing lipid intermediates across the endoplasmic reticulum membrane, thereby ensuring proper glycosylation of proteins . Structurally, the protein contains multiple transmembrane domains and is localized to the endoplasmic reticulum, where glycosylation processes are initiated .

How should recombinant MPDU1 protein be stored and reconstituted for optimal stability?

For optimal stability of recombinant Cricetulus griseus MPDU1 protein:

  • Storage conditions:

    • Long-term storage: -20°C or -80°C

    • Shelf life in liquid form: approximately 6 months at -20°C/-80°C

    • Shelf life in lyophilized form: approximately 12 months at -20°C/-80°C

    • Working aliquots: 4°C for up to one week

  • Reconstitution protocol:

    • Briefly centrifuge the vial before opening

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% is typically recommended)

    • Aliquot for long-term storage to avoid repeated freeze-thaw cycles

What are the primary applications of recombinant MPDU1 in glycobiology research?

Recombinant MPDU1 protein serves multiple research applications:

  • Functional studies: Investigating the role of MPDU1 in dolichol-phosphate-mannose utilization and glycosylation pathways

  • Antibody production: Generating specific antibodies against MPDU1 for immunodetection experiments

  • Protein-protein interaction studies: Identifying binding partners in the glycosylation machinery

  • Enzyme activity assays: Assessing mannose incorporation into glycoproteins

  • Disease modeling: Understanding the molecular mechanisms of MPDU1-CDG (Congenital Disorder of Glycosylation)

How can researchers accurately model MPDU1 mutations associated with Congenital Disorders of Glycosylation?

To effectively model MPDU1 mutations:

  • Site-directed mutagenesis approach:

    • Engineer specific mutations (e.g., c.503G>A/p.Gly168Glu) into expression vectors containing wild-type MPDU1 cDNA

    • Express mutant proteins in appropriate cell lines (typically fibroblasts or CHO cells)

    • Compare glycosylation profiles between wild-type and mutant MPDU1-expressing cells

  • Patient-derived cell models:

    • Establish fibroblast cultures from MPDU1-CDG patients

    • Use as primary models for studying disease mechanisms

    • Perform rescue experiments by introducing wild-type MPDU1

  • Analysis methods:

    • Examine lipid-linked oligosaccharide profiles

    • Assess DPM levels

    • Measure O-mannosylation of α-dystroglycan

    • Evaluate transferrin glycoform patterns by isoelectric focusing or mass spectrometry

The following table summarizes key biochemical parameters that should be assessed in MPDU1 mutation models:

ParameterWild-type MPDU1MPDU1 MutantsAnalytical Method
Lipid-linked oligosaccharidesNormal lengthShortenedHPLC, mass spectrometry
DPM levelsNormalReducedThin-layer chromatography
O-mannosylation of α-dystroglycanNormalReducedWestern blot, IFA
Serum transferrin glycoformsNormalElevated disialotransferrinIsoelectric focusing
Creatine kinase levelsNormalElevatedBiochemical assay

What strategies can resolve conflicting data when characterizing novel MPDU1 variants?

When faced with conflicting data regarding novel MPDU1 variants:

  • Comprehensive variant assessment:

    • Perform in silico analysis using multiple prediction algorithms (PolyPhen-2, SIFT, MutationTaster)

    • Assess evolutionary conservation across species

    • Analyze structural implications using protein modeling

    • Check variant frequency in population databases (gnomAD, 1000 Genomes)

  • Functional validation experiments:

    • Conduct complementation assays in MPDU1-deficient cell lines

    • Perform glycosylation rescue experiments

    • Use CRISPR/Cas9 to introduce the variant into wild-type cells

    • Compare results with known pathogenic variants

  • Integration of clinical and biochemical data:

    • Correlate molecular findings with patient phenotypes

    • Perform family co-segregation studies

    • Compare biochemical profiles with established MPDU1-CDG cases

    • Consider the possibility of modifier genes affecting phenotypic expression

How do defects in MPDU1 lead to both CDG-I and dystroglycanopathy phenotypes?

The dual pathophysiology of MPDU1 deficiency involves:

  • N-glycosylation defects (CDG-I pathway):

    • Impaired utilization of dolichol-phosphate-mannose

    • Shortened lipid-linked oligosaccharides

    • Reduced transfer of oligosaccharides to nascent proteins

    • Results in elevated disialotransferrin in serum

  • O-mannosylation defects (dystroglycanopathy pathway):

    • Reduced O-mannosylation of alpha-dystroglycan (α-DG)

    • Compromised α-DG function as an extracellular matrix receptor

    • Disrupted laminin-dystroglycan interactions

    • Manifests as muscle, eye, and brain abnormalities

This dual mechanism explains the overlapping clinical features observed in patients, including:

  • Hypotonia and elevated creatine kinase (muscle involvement)

  • Dilated cardiomyopathy (cardiac involvement)

  • Buphthalmos and congenital glaucoma (ocular involvement)

  • Developmental delay and structural brain abnormalities (neurological involvement)

What are the optimal expression systems for producing functional recombinant MPDU1 protein?

When selecting an expression system for MPDU1 production, researchers should consider:

  • Yeast expression systems:

    • Advantages: Post-translational modifications similar to mammals, high protein yield

    • Specific platforms: Pichia pastoris, Saccharomyces cerevisiae

    • Optimal for: Functional studies requiring properly folded protein

    • Key consideration: Codon optimization for improved expression

  • Mammalian expression systems:

    • Advantages: Native glycosylation pattern, proper folding

    • Specific platforms: CHO cells, HEK293

    • Optimal for: Structural studies, antibody production

    • Key consideration: Lower yield compared to other systems

  • Expression optimization strategies:

    • Use of strong inducible promoters

    • Incorporation of appropriate secretion signals

    • Addition of purification tags (His, GST, FLAG)

    • Temperature and pH optimization during induction

    • Supplementation with appropriate cofactors

How can researchers distinguish between primary MPDU1 dysfunction and secondary glycosylation abnormalities?

To differentiate primary MPDU1 defects from secondary glycosylation abnormalities:

  • Genetic confirmation:

    • Sequence MPDU1 gene to identify pathogenic variants

    • Perform deletion/duplication analysis if point mutations aren't detected

    • Analyze parents for carrier status (autosomal recessive inheritance)

  • Complementation assays:

    • Introduce wild-type MPDU1 into patient cells

    • Monitor rescue of glycosylation abnormalities

    • Quantify normalization of lipid-linked oligosaccharide profiles

  • Biomarker analysis:

    • Assess serum transferrin glycoforms (specific pattern in MPDU1-CDG)

    • Analyze multiple glycoproteins to establish a comprehensive glycosylation profile

    • Examine tissue-specific biomarkers (e.g., dystroglycan in muscle biopsies)

  • Comparative analysis with other CDG types:

    • Compare with DPM1-CDG, DPM2-CDG, and DPM3-CDG profiles

    • Assess specific markers distinguishing MPDU1-CDG from other disorders

    • Evaluate response to mannose supplementation in experimental settings

What are the most sensitive techniques for detecting altered glycosylation patterns in MPDU1 deficiency?

Several complementary analytical techniques provide comprehensive assessment of glycosylation defects:

  • Mass spectrometry-based approaches:

    • MALDI-TOF MS of serum transferrin

    • LC-MS/MS of isolated glycans

    • Glycopeptide analysis for site-specific glycosylation

    • Advantages: High sensitivity, structural information

    • Limitations: Requires specialized equipment, complex data analysis

  • Electrophoretic techniques:

    • Isoelectric focusing of serum transferrin

    • 2D electrophoresis of multiple glycoproteins

    • Advantages: Relatively simple, established clinical protocols

    • Limitations: Limited structural information

  • Lectin-based methods:

    • Lectin blotting of glycoproteins

    • Lectin affinity chromatography

    • Flow cytometry with fluorescent lectins

    • Advantages: Specific for certain glycan structures

    • Limitations: Variable specificity, semi-quantitative

  • Imaging techniques for O-mannosylation assessment:

    • Immunofluorescence with IIH6 antibody (recognizes glycosylated α-dystroglycan)

    • Laminin overlay assays

    • Advantages: Visualization of functional glycosylation

    • Limitations: Subjective interpretation

How should researchers design experiments to evaluate MPDU1 involvement in ciliopathy-like disorders?

Based on recent findings linking MPDU1 mutations to ciliopathy-like phenotypes, researchers should:

  • Ciliary structure and function assessment:

    • Immunofluorescence microscopy of primary cilia in patient fibroblasts

    • Electron microscopy to examine ciliary ultrastructure

    • Live-cell imaging to assess ciliary dynamics

    • Ciliary protein trafficking assays

  • Glycosylation analysis of ciliary proteins:

    • Identify key ciliary proteins requiring proper glycosylation

    • Assess glycosylation status of selected ciliary proteins

    • Evaluate ciliary localization of glycosylated proteins

  • Model systems:

    • MPDU1-knockout or knockdown in ciliated cell lines

    • CRISPR/Cas9-engineered cells harboring patient-specific mutations

    • Zebrafish or mouse models with MPDU1 deficiency

    • Examination of tissue-specific effects on ciliated structures

  • Clinical correlation studies:

    • Detailed phenotyping of patients with MPDU1 mutations

    • Special focus on ciliopathy features:

      • Renal cortical tubular and glomerular cysts

      • Hepatic duct plate malformation

      • Central nervous system abnormalities

      • Retinal involvement

What experimental therapeutic approaches show promise for MPDU1-associated disorders?

Current experimental therapeutic strategies include:

  • Substrate supplementation approaches:

    • Mannose supplementation trials

    • Rationale: Increasing substrate availability may partially overcome defective utilization

    • Considerations: Dose optimization, timing of intervention, combination with other therapies

  • Gene therapy strategies:

    • AAV-mediated gene delivery of wild-type MPDU1

    • Target tissues: Liver, muscle, central nervous system

    • Challenges: Delivery to affected tissues, potential immune responses

    • Current status: Preclinical development

  • Molecular chaperone therapy:

    • Small molecules that stabilize mutant MPDU1 protein

    • Potential for missense mutations resulting in misfolding

    • High-throughput screening approaches to identify candidates

    • Considerations: Mutation-specific responses

  • Antisense oligonucleotide therapy:

    • For mutations affecting splicing

    • Exon skipping or inclusion strategies

    • Personalized approach based on specific mutations

    • Delivery challenges similar to gene therapy

How can researchers establish reliable outcome measures for experimental therapies targeting MPDU1 deficiency?

To effectively evaluate therapeutic interventions:

  • Biochemical markers:

    • Normalization of transferrin glycoforms

    • Improvement in lipid-linked oligosaccharide profiles

    • Rescue of α-dystroglycan glycosylation

    • Advantages: Objective, quantifiable

    • Limitations: May not correlate directly with clinical improvement

  • Functional outcome measures:

    • Muscle strength assessments

    • Cardiac function parameters

    • Neurological development milestones

    • Liver and kidney function tests

    • Advantages: Clinically relevant

    • Limitations: May be affected by disease progression

  • Tissue-specific biomarkers:

    • Muscle: Creatine kinase levels, muscle biopsy findings

    • Liver: Biliary duct imaging, hepatic enzyme profiles

    • Brain: MRI findings, neurocognitive assessments

    • Advantages: Organ-specific monitoring

    • Limitations: Invasive procedures may be required

  • Quality of life measures:

    • Age-appropriate functional scales

    • Patient/caregiver-reported outcomes

    • Advantages: Patient-centered approach

    • Limitations: Subjective component

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.