Recombinant Cricetulus griseus Metallophosphoesterase 1 (MPPE1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MPPE1; PGAP5; Metallophosphoesterase 1; Post-GPI attachment to proteins factor 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-391
Protein Length
full length protein
Species
Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
Target Names
MPPE1
Target Protein Sequence
MALVRWRLRRGNFHLLSRVLLLKLTVVIISVLLFCEYFIYHLVIFQCHWPEVKTLAHGDR QKPVLKAMFLADTHLLGEIRGHWLDKLRREWQMERAFQTALWWLQPEVIFILGDIFDEGK WSTTEAWADDVQRFRKIFRHGSHVQLKVVIGNHDIGFHYQMSKYRIKRFEKVFSSERLFS WKGVNFVMVNSVAMEGDGCSICSEAEAELREISRKLNCSREVQGSSQCEGEQRLPFSAPV LLQHYPLYRASDANCSGEDAAPPEERNVPFEEKYDVLSREASQKLLWWLQPRLVLSGHTH SACEVLHPGGVPEVSVPSFSWRNRNNPSFIMGSLTSKDYALSKCYLPFEDRVLATYGAAA VFLVVLILAHLERLPSSFLFGWKLRKMHMRG
Uniprot No.

Target Background

Function

Metallophosphoesterase 1 (MPPE1) is essential for the transport of glycosylphosphatidylinositol (GPI)-anchored proteins from the endoplasmic reticulum to the Golgi apparatus. It plays a critical role in GPI-anchor lipid remodeling by removing an ethanolamine-phosphate (EtNP) side chain from the second mannose (Man2) residue of the GPI intermediate. This enzymatic activity is crucial for the efficient trafficking of GPI-anchored proteins.

Database Links
Protein Families
Metallophosphoesterase superfamily, MPPE1 family
Subcellular Location
Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein. Note=Also localizes to endoplasmic reticulum exit site.

Q&A

What is Cricetulus griseus MPPE1 and what is its primary function?

Cricetulus griseus MPPE1 (Metallophosphoesterase 1) is a 391 amino acid protein that functions as a specialized metallophosphoesterase required for the transport of GPI-anchored proteins from the endoplasmic reticulum to the Golgi apparatus. According to UniProtKB data, MPPE1 (also known as PGAP5) mediates a critical lipid remodeling step in GPI-anchor maturation, specifically removing the side-chain ethanolamine-phosphate (EtNP) from the second mannose (Man2) of the GPI intermediate . This processing is essential for efficient transport of GPI-anchored proteins to their final destinations.

MPPE1 contains several key structural features:

  • Two transmembrane helices (positions 25-45 and 352-372)

  • Seven metal-binding sites coordinating two manganese ions per subunit

  • A characteristic metallophosphoesterase domain (positions 66-301)

The protein localizes to the endoplasmic reticulum-Golgi intermediate compartment membrane and the cis-Golgi network membrane, positioning it optimally for its role in the secretory pathway .

What is the relationship between MPPE1 and GPI anchor biosynthesis?

MPPE1 plays a specific and crucial role in GPI anchor processing that directly impacts protein trafficking:

  • Biochemical function: MPPE1 removes the ethanolamine-phosphate group from the second mannose residue of the GPI anchor

  • Trafficking consequence: This modification is required for efficient export of GPI-anchored proteins from the ER

  • Quality control: MPPE1 represents a key checkpoint in the secretory pathway for GPI-anchored proteins

  • Subcellular localization: The protein strategically positions at the ER-Golgi interface to facilitate this transition

The sequential processing of GPI anchors, including MPPE1's contribution, ensures proper maturation and trafficking of numerous cell surface proteins involved in diverse cellular functions from signaling to adhesion.

What expression systems are most effective for producing recombinant Cricetulus griseus MPPE1?

Each expression system offers distinct advantages for MPPE1 production, with selection depending on research objectives:

Expression SystemAdvantagesLimitationsRecommended Applications
E. coliHigh yield, rapid growth, cost-effectiveLimited post-translational modifications, challenging for membrane proteinsTruncated soluble domains, high-throughput screening
Yeast (P. pastoris)Eukaryotic processing, scalable, moderate costHyperglycosylation may occurFull-length protein with mammalian-like modifications
Insect cellsComplex post-translational modifications, better foldingHigher cost than microbial systems, variable glycosylationStructural studies, activity assays requiring authentic folding
Mammalian cells (CHO)Native-like processing, authentic foldingHighest cost, longer production timeFunctional studies, protein-protein interaction analysis

For MPPE1, insect cell expression using baculovirus systems has demonstrated particular success for membrane proteins requiring manganese coordination . Coexpression with chaperones like BiP can significantly enhance proper folding and yields of functional protein.

What purification strategies maintain MPPE1 stability and activity?

Purifying MPPE1 while preserving its native structure and activity requires careful attention to several critical factors:

  • Membrane extraction protocol:

    • Gentle solubilization using mild detergents (DDM, LMNG at 1-2% w/v)

    • Inclusion of stabilizing agents (glycerol 10%, cholesterol hemisuccinate)

    • Maintaining physiological pH (7.2-7.5) throughout extraction

  • Metal cofactor preservation:

    • Inclusion of 1-5 mM MnCl₂ in all buffers

    • Avoiding EDTA and other chelating agents

    • Monitoring metal content using ICP-MS during purification

  • Chromatography sequence:

    • Initial IMAC purification using His-tag (if incorporated)

    • Intermediate ion exchange step to remove contaminants

    • Final size exclusion chromatography in appropriate detergent micelles (0.05% DDM or equivalent)

  • Activity preservation strategy:

    • Rapid processing at 4°C throughout purification

    • Addition of lipids (0.01-0.05 mg/ml) to stabilize membrane protein

    • Immediate activity assessment following each purification step

The effectiveness of this approach can be monitored by measuring phosphodiesterase activity using synthetic substrates like bis(p-nitrophenyl) phosphate, with proper controls including EDTA to confirm metal-dependent activity.

How can researchers verify the enzymatic activity of recombinant MPPE1?

Verifying MPPE1 activity requires assays that specifically measure its metallophosphoesterase function. Several complementary approaches are recommended:

  • Generic phosphodiesterase activity assay:

    • Substrate: bis(p-nitrophenyl) phosphate

    • Detection: Spectrophotometric measurement at 405 nm

    • Expected activity: 2-10 μmol/min/mg protein (depending on preparation)

    • Controls: EDTA inhibition confirms metal-dependent mechanism

  • GPI anchor processing assay:

    • Substrate: Synthetic GPI anchor precursors with EtNP on Man2

    • Detection: Mass spectrometry to monitor EtNP removal

    • Analysis: Comparison of processed vs. unprocessed GPI profiles

  • Cell-based trafficking assay:

    • System: MPPE1-deficient cells expressing fluorescently tagged GPI-anchored reporter

    • Methodology: Complementation with wild-type or mutant MPPE1

    • Readout: Quantitative imaging of reporter trafficking to cell surface

    • Expected result: Wild-type MPPE1 rescues trafficking defects

  • Metal-binding verification:

    • Technique: Isothermal titration calorimetry with MnCl₂

    • Expected stoichiometry: 2 Mn²⁺ ions per MPPE1 molecule

    • Controls: Mutants of key metal-binding residues show reduced binding

A comprehensive activity assessment should employ multiple approaches to confirm both the biochemical activity and biological function of the recombinant protein.

What experimental design principles are critical when studying MPPE1 variants?

Poor experimental design represents the most common pitfall in recombinant protein studies, with particularly severe consequences for MPPE1 research. According to analysis of numerous studies, approximately 95% contain major experimental design flaws . To ensure reliable MPPE1 research:

  • Randomization and blocking:

    • Randomize samples across expression batches to avoid confounding

    • Implement blocking designs to account for unavoidable batch effects

    • Include phenotype-balanced samples in each experimental run

  • Statistical considerations:

    • Perform power calculations to determine required replication (typically n≥4 biological replicates)

    • Implement appropriate multiple testing corrections

    • Use mixed-effects models to account for nested experimental factors

  • Controls hierarchy:

    • Negative controls: Empty vector, catalytically inactive mutant (e.g., metal-binding site mutations)

    • Positive controls: Well-characterized wild-type MPPE1, commercially validated samples

    • Process controls: Mock purifications to identify contaminant activities

  • Validation strategy:

    • Verify findings using orthogonal assays

    • Confirm results in multiple cell types or expression systems

    • Demonstrate dose-dependence for activity measurements

  • Batch effect mitigation:

    • Implement standardized protocols with minimal variation

    • Record and report all potential confounding variables

    • Apply computational batch correction when combining experiments

Implementing these principles helps avoid the spurious associations and irreproducible findings that have plagued many recombinant protein studies, as highlighted in the Golden Helix analysis .

How does MPPE1 function impact glycoprotein production in biotechnology applications?

MPPE1's role in GPI anchor processing has significant implications for biopharmaceutical production, particularly in CHO cell systems:

  • Glycosylation engineering opportunities:

    • The CHO glycosylation mutant collection described by researchers includes MPPE1-modified lines that produce proteins with altered glycosylation patterns

    • EPO-Fc and trastuzumab produced in these mutants demonstrated how glycan modifications affect Fc receptor binding and ADCC activity

    • Specific mutants produced proteins with uniform Man5 N-glycans, highlighting potential for controlled glycoform engineering

  • Production parameter considerations:

    • MPPE1 function is sensitive to culture conditions including pH, temperature, and metal availability

    • Manganese supplementation may enhance MPPE1 activity in production cultures

    • Optimizing these parameters can improve consistency of glycoform distributions

  • Quality attributes impact:

    • MPPE1-dependent GPI anchor processing affects:

      • Protein secretion efficiency

      • Final subcellular localization of GPI-anchored proteins

      • Interactions with other components of the secretory pathway

  • Therapeutic relevance:

    • GPI-anchor processing affects antibody-dependent cellular cytotoxicity (ADCC) in therapeutic antibodies

    • Human β-glucocerebrosidase produced with uniform Man5 N-glycans in MPPE1-modified cells shows enhanced therapeutic efficacy

These findings highlight MPPE1 as a potential target for cell line engineering to enhance biopharmaceutical production and quality attributes.

What is the evidence linking MPPE1 variants to human disease, and how can recombinant MPPE1 research contribute to understanding these associations?

Several studies have identified associations between MPPE1 variants and neuropsychiatric conditions:

  • Bipolar disorder association:

    • Genetic linkage studies position a bipolar disorder susceptibility locus on chromosome 18p11, where MPPE1 is located

    • Single marker analysis revealed significant association of SNP rs3974590 with bipolar disorder (P = 0.009; permutation corrected P = 0.046)

    • The metallophosphoesterase activity of MPPE1 connects to dysregulated protein phosphorylation pathways implicated in neuropsychiatric disorders

  • Neurodevelopmental disorder evidence:

    • MPPE1 variants have been identified in complex neurodevelopmental disorders with severe presentations

    • Functional consequences likely relate to abnormal trafficking of GPI-anchored neuronal proteins

    • Research is ongoing to establish mechanistic links between specific variants and phenotypes

  • Research approaches using recombinant MPPE1:

    • Expression of disease-associated variants to assess functional consequences on:

      • Enzymatic activity (phosphodiesterase assays)

      • Protein stability and folding (thermal shift assays)

      • GPI-anchored protein trafficking (cell-based assays)

    • CRISPR-edited cellular models expressing variant MPPE1 to observe effects on neurodevelopmental processes

    • Structural biology approaches to understand how variants alter MPPE1 function

  • Therapeutic implications:

    • Identifying small molecules that restore function of variant MPPE1

    • Exploring bypass mechanisms to compensate for MPPE1 dysfunction

    • Developing biomarkers of aberrant GPI-anchor processing

This research represents a prime example of translating basic biochemical understanding into clinically relevant insights, potentially leading to new diagnostic and therapeutic approaches.

What methods can reveal the protein interaction network of MPPE1 in the GPI anchor biosynthetic pathway?

Understanding MPPE1's protein interactions provides critical insight into its functional context within the GPI anchor biosynthetic pathway. Multiple complementary approaches are recommended:

  • Proximity-based labeling techniques:

    • BioID fusion: MPPE1 fused to modified biotin ligase labels proximal proteins

    • APEX2 fusion: Engineered peroxidase catalyzes biotinylation of nearby proteins

    • TurboID: Faster labeling kinetics suitable for capturing transient interactions

    • Analysis: Mass spectrometry identification of biotinylated proteins

    • Advantage: Captures in vivo interactions in membrane compartments

  • Crosslinking mass spectrometry (XL-MS):

    • Methodology: Cell-permeable crosslinkers stabilize protein complexes before analysis

    • Data analysis: Specialized algorithms identify crosslinked peptides

    • Outcome: Provides spatial constraints for interaction modeling

    • Example application: Identifying interaction surfaces between MPPE1 and TMED10

  • Functional genomics screening:

    • CRISPR screens to identify genes that modify MPPE1-dependent phenotypes

    • Synthetic lethal screens with MPPE1 mutants

    • Suppressor screens to identify compensatory pathways

    • Analysis: Network modeling to place MPPE1 in functional pathways

  • Co-fractionation approaches:

    • Size exclusion chromatography combined with mass spectrometry (SEC-MS)

    • Gradient fractionation of cellular compartments

    • Analysis: Correlation profiling to identify co-migrating proteins

    • Advantage: Preserves native membrane protein complexes

  • Structural biology integration:

    • Cryo-EM of MPPE1-containing complexes

    • Hydrogen-deuterium exchange mass spectrometry

    • Integrative modeling combining multiple data types

    • Outcome: Three-dimensional models of MPPE1 interaction networks

These approaches have revealed that MPPE1 interacts with GPI-anchored proteins and TMED10 , suggesting a role in cargo selection for vesicular transport from the ER to the Golgi.

How does Cricetulus griseus MPPE1 compare to human MPPE1, and what are the implications for translational research?

Comparative analysis of Chinese hamster and human MPPE1 reveals important similarities and differences relevant to translational applications:

FeatureCricetulus griseus MPPE1Human MPPE1Translational Significance
Sequence Length391 amino acids 400 amino acids Minor size differences may affect protein dynamics
Sequence IdentityReference~92% identityHigh conservation suggests functional equivalence
Metallophosphoesterase DomainPositions 66-301 Similarly positionedCore catalytic function conserved across species
Metal Binding Sites7 conserved residues Identical coordinationManganese-dependent mechanism preserved
Transmembrane Topology2 transmembrane helices 2 transmembrane helicesMembrane integration pattern maintained
Subcellular LocalizationER-Golgi intermediate compartment Same localizationConsistent with conserved trafficking function
Post-translational ModificationsSpecies-specific patternsHuman-specific patternsMay affect protein stability and regulation

The high degree of conservation between these orthologs supports the use of CHO cells as expression systems for human GPI-anchored proteins, while subtle differences may explain species-specific aspects of GPI-anchor processing. The cross-species compatibility of MPPE1 function provides a foundation for translating findings from hamster to human applications, particularly in biopharmaceutical production and disease modeling.

What considerations are important when designing experiments using recombinant MPPE1 from different species?

When designing experiments with recombinant MPPE1 from different species, researchers should consider several critical factors:

  • Expression system compatibility:

    • Match expression system to the source of MPPE1 when possible

    • Consider codon optimization for the expression host

    • Account for species-specific post-translational modifications

  • Functional conservation assessment:

    • Compare key parameters across species variants:

      • Enzymatic kinetics (Km, Vmax, substrate specificity)

      • Cofactor requirements (manganese binding affinity)

      • Temperature and pH optima

      • Inhibitor sensitivity profiles

  • Experimental controls for cross-species studies:

    • Include both species variants when making direct comparisons

    • Use species-matched substrates when available

    • Consider chimeric constructs to identify functionally divergent domains

  • Interpretation of disease-relevant variants:

    • Exercise caution when modeling human disease mutations in non-human MPPE1

    • Confirm that the structural context of the mutation is conserved

    • Validate findings in human cellular systems when possible

  • Antibody selection considerations:

    • Verify epitope conservation when using antibodies across species

    • Consider developing species-specific antibodies for critical applications

    • Use epitope tagging strategies that minimize functional interference

  • Heterologous expression recommendations:

    • For structural studies: Insect cell expression often provides optimal yield/quality balance

    • For functional studies: Species-matched cellular background provides most relevant context

    • For high-throughput screening: Bacterial expression of soluble domains may be sufficient

These considerations help ensure that experimental findings with recombinant MPPE1 from one species can be appropriately translated to other species contexts, particularly for medical and biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.