Recombinant Cricetulus griseus P2Y purinoceptor 2 (P2RY2)

Shipped with Ice Packs
In Stock

Description

Recombinant Expression Systems

The recombinant production of Cricetulus griseus P2RY2 employs various expression systems to generate functional protein for research applications. As with many GPCRs, the choice of expression system significantly impacts the quality, yield, and functionality of the recombinant protein. Multiple host systems have been successfully utilized for P2RY2 expression, including bacterial (E. coli), yeast, baculovirus, and mammalian cell systems . Each expression platform offers distinct advantages and limitations for the production of this membrane receptor.

Recombinant P2RY2 produced in these systems typically achieves purity levels of 85% or greater, as determined by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) analysis . This level of purity is essential for downstream applications requiring minimal contaminants. The expression constructs often incorporate affinity tags, particularly histidine (His) tags, which facilitate purification through immobilized metal affinity chromatography . These expression systems can produce both partial and full-length versions of the receptor, with the complete sequence being preferable for functional studies.

Expression HostAdvantagesTypical PurityCommon Tags
E. coliHigh yield, cost-effective≥85% (SDS-PAGE)His tag
YeastPost-translational modifications≥85% (SDS-PAGE)His tag
BaculovirusEukaryotic processing≥85% (SDS-PAGE)His tag
Mammalian CellNative-like folding and modifications≥85% (SDS-PAGE)His tag

For optimal stability and activity, recombinant P2RY2 preparations typically require careful handling, including proper storage conditions. The purified protein is often lyophilized and stored at -20°C or -80°C, with recommendations to avoid repeated freeze-thaw cycles that could compromise its integrity . Reconstitution protocols generally suggest using deionized sterile water to achieve concentrations of 0.1-1.0 mg/mL, often with the addition of glycerol (5-50% final concentration) for long-term storage .

Applications in Research and Biotechnology

Recombinant Cricetulus griseus P2RY2 serves multiple purposes in scientific research and biotechnological applications. Primary uses include:

Receptor-Ligand Interaction Studies

The purified recombinant protein provides a platform for investigating binding interactions with natural nucleotide ligands (ATP, UTP) and synthetic receptor modulators. These studies contribute to our understanding of ligand specificity, binding kinetics, and structure-activity relationships . For instance, agonist-induced responses can be measured to determine EC50 values, such as those observed for UTP-mediated activation of P2Y2R signaling pathways .

Antibody Development and Validation

Recombinant P2RY2 is employed in the production and validation of receptor-specific antibodies. Polyclonal antibodies against P2RY2 have been developed using recombinant proteins as immunogens, with applications in Western blotting, immunohistochemistry, and immunofluorescence techniques . These antibodies demonstrate reactivity across multiple species, including human, mouse, and rat samples, indicating conservation of key epitopes across species boundaries .

Functional Assays and Signaling Studies

The recombinant receptor enables detailed investigation of P2Y2-mediated signaling pathways. Studies utilizing recombinant P2Y2 receptors have elucidated their role in activating Rho and Rac signaling pathways, stress fiber formation, and chemotaxis . These functional assays provide critical insights into the receptor's biological roles and potential therapeutic targeting strategies.

Comparative Analysis with P2RY2 from Other Species

The Cricetulus griseus (Chinese hamster) P2RY2 shares significant homology with P2Y2 receptors from other mammalian species, particularly those from humans and rats. Comparative analysis of these orthologs provides valuable insights into evolutionary conservation and species-specific adaptations in receptor structure and function.

Functional Equivalence and Species Variations

While the Cricetulus griseus P2RY2 presumably shares core signaling mechanisms with its human counterpart, species-specific variations in signaling efficiency, ligand specificity, and regulatory mechanisms may exist. These differences could influence experimental outcomes when using recombinant receptors from different species and should be considered when interpreting cross-species data.

The conservation of the RGD integrin-binding motif across species suggests the evolutionary importance of integrin-receptor interactions for P2Y2 function. Studies with human P2Y2R have demonstrated that this domain is essential for integrin-dependent signaling , and similar functionality likely exists for the Chinese hamster ortholog, though specific experimental confirmation is limited in the available data.

Future Research Directions

Research on Recombinant Cricetulus griseus P2RY2 continues to evolve, with several promising directions for future investigation:

Species-Specific Signaling Characteristics

Comparative studies between Chinese hamster P2RY2 and its orthologs from other species could reveal species-specific adaptations in receptor function and regulation. Such investigations would enhance our understanding of evolutionary conservation in purinergic signaling systems and potentially identify unique features of the Chinese hamster receptor that could be exploited for biotechnological applications.

Development of Improved Recombinant Production Systems

Ongoing advancements in protein expression and purification technologies may lead to enhanced methods for producing recombinant P2RY2 with improved yield, stability, and functional characteristics. Alternative expression hosts, novel solubilization strategies, and innovative purification approaches could overcome current limitations in recombinant GPCR production.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
P2RY2; P2Y purinoceptor 2; P2Y2; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
Target Names
Target Protein Sequence
VHRCLGVLRPLHSLRWGRARYARRVAAVVWVLVLACQAPVLYFVTTSVRGTRITCHDTSA RELFSHFVAYSSVMLSLLFAVPFSVILVCYVLMARRLLKPAYGTTGGLPRAKRKSVRTIA LVLAVFTLCFLPFHVTRTLYYSFRSLDLSCHTLNAINMAYKITRPL
Uniprot No.

Target Background

Function
A G-protein-coupled receptor for ATP and UTP, activating a phosphatidylinositol-calcium second messenger system.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and classification of P2Y purinoceptor 2?

P2Y purinoceptor 2 (P2RY2) belongs to the family of G protein-coupled receptors characterized by seven transmembrane spanning regions, a structural feature common to other G protein-coupled receptors. Unlike P2X receptors which function as ion channels with two transmembrane spanning regions, P2Y receptors like P2RY2 operate through signal transduction pathways. The functional P2RY2 protein exhibits the characteristic seven-transmembrane domain architecture that facilitates its coupling to G proteins and subsequent downstream signaling events . For recombinant expression studies, the Cricetulus griseus (Chinese hamster) variant is frequently used as a model system due to its high homology with human P2RY2 and compatibility with various expression systems including E. coli, yeast, baculovirus, and mammalian cell systems .

What expression systems are most efficient for producing functional Recombinant Cricetulus griseus P2RY2?

Multiple expression systems have been employed successfully for producing Recombinant Cricetulus griseus P2RY2, with each system offering distinct advantages depending on the research objectives:

Expression SystemAdvantagesTypical PurityRecommended Applications
E. coliCost-effective, high yield, rapid production≥85% by SDS-PAGEStructural studies, antibody production
YeastPost-translational modifications, higher yield than mammalian systems≥85% by SDS-PAGEFunctional studies requiring glycosylation
BaculovirusComplex eukaryotic processing, high expression levels≥85% by SDS-PAGESignaling studies, protein-protein interaction analysis
Mammalian CellNative-like processing, proper folding and modifications≥85% by SDS-PAGEPharmacological studies, cell-based assays
Cell-Free ExpressionRapid production, avoids cellular toxicity issues≥85% by SDS-PAGEPreliminary characterization, high-throughput screening

Researchers should select the expression system based on their specific requirements for protein yield, post-translational modifications, and functional activity. For studies investigating ligand binding or G protein coupling, mammalian expression systems typically provide the most physiologically relevant preparation .

How can researchers verify the functional activity of recombinant P2RY2?

Verification of functional P2RY2 activity requires multi-parameter assessment approaches:

  • Calcium Mobilization Assay: Implement microfluorimetric measurements with calcium-sensitive dyes like fura-2 to measure intracellular calcium responses. Functional P2RY2 should demonstrate concentration-dependent increases in intracellular calcium ([Ca²⁺]ᵢ) in response to ATP or UTP application. Typically, brief application of 300 μM ATP or UTP should elicit transient increases in [Ca²⁺]ᵢ of approximately 270-280 nM .

  • Agonist Potency Profile: Verify the characteristic pharmacological profile where ATP = UTP > 2-MeSATP > ADP >> adenosine, which is consistent with P2Y2 purinoceptor functionality .

  • Antagonist Sensitivity: Confirm inhibition by P2 purinoceptor antagonists such as PPADS (10 μM should completely block responses) and partial inhibition by suramin (100 μM) .

  • G Protein Coupling Assessment: Determine coupling to phospholipase C pathways using inhibitors like U-73122, which should significantly reduce ATP-induced calcium responses if the receptor is functional .

  • Electrophysiological Recordings: In appropriate cell systems, perform patch-clamp recordings to detect ATP/UTP-evoked currents that coincide with calcium rises .

These methods provide comprehensive validation of recombinant P2RY2 functionality before proceeding with more complex experimental applications.

What are the optimal approaches for studying P2RY2-mediated signaling pathways in inflammatory responses?

Investigating P2RY2-mediated signaling in inflammatory contexts requires sophisticated experimental designs that capture the complex interplay between P2RY2 activation and downstream inflammatory cascades:

  • Conditional Knockout Models: Employ cell-type specific Cre-recombinase systems (e.g., epithelial-specific, myeloid-specific, or dendritic cell-specific) to generate conditional P2RY2 knockout mice. This approach allows precise investigation of cell-type specific contributions to inflammatory responses, as demonstrated in house dust mite (HDM)-induced allergic airway inflammation models .

  • Calcium Signaling Analysis: Implement real-time calcium imaging with ratiometric indicators combined with pharmacological interventions to dissect the contribution of various calcium sources:

    • Use calcium-free media to distinguish between intracellular store release and extracellular calcium influx

    • Apply store-depleting agents like cyclopiazonic acid (10 μM) to assess endoplasmic reticulum contribution

    • Test ryanodine (10 μM) and caffeine (5 mM) sensitivity to evaluate ryanodine receptor involvement

  • G Protein Coupling Characterization: Apply pertussis toxin treatment to determine the involvement of Gᵢ/ₒ proteins versus other G protein subtypes. This helps map the specific signaling branches activated by P2RY2 in inflammatory contexts .

  • Phospholipase C Pathway Analysis: Utilize specific inhibitors like U-73122 to confirm the role of PLC in generating second messengers (IP₃ and DAG) that trigger calcium release and protein kinase C activation, respectively .

  • Inflammatory Mediator Profiling: Quantify cytokine/chemokine production and immune cell recruitment patterns in response to P2RY2 activation or inhibition to establish causative relationships in inflammatory pathologies .

This multi-parameter approach enables comprehensive characterization of P2RY2's role in inflammatory signaling networks.

How can researchers effectively differentiate between P2RY2 and other purinergic receptor subtypes in experimental systems?

Distinguishing P2RY2 from other purinergic receptors requires a strategic combination of pharmacological, molecular, and genetic approaches:

  • Selective Agonist Profiling: Exploit the characteristic agonist profile of P2RY2 where ATP and UTP demonstrate equal potency. This distinguishes P2RY2 from other P2Y subtypes that show differential sensitivity to these nucleotides. The complete profile (ATP = UTP > 2-MeSATP > ADP >> adenosine) is highly characteristic of P2RY2 .

  • RT-PCR Verification: Implement reverse transcriptase-polymerase chain reaction (RT-PCR) with subtype-specific primers to confirm expression of P2RY2 mRNA alongside other potentially expressed purinergic receptors. This molecular approach provides definitive identification of receptor subtypes present in the experimental system .

  • Antagonist Sensitivity Pattern: Utilize the differential sensitivity to antagonists, where P2RY2 responses are completely blocked by 10 μM PPADS but only partially inhibited by 100 μM suramin, unlike other P2Y subtypes that show different antagonist sensitivity patterns .

  • Genetic Knockdown/Knockout Validation: Apply siRNA knockdown or CRISPR-Cas9 gene editing to selectively reduce or eliminate P2RY2 expression, then measure functional responses to ATP/UTP to confirm the specific contribution of P2RY2 versus other receptors .

  • Calcium Response Kinetics: Analyze temporal characteristics of calcium signals, as different receptor subtypes often produce distinct kinetic signatures that can be used for identification purposes .

This comprehensive approach ensures accurate attribution of observed effects to P2RY2 rather than other purinergic receptor subtypes.

What methodological considerations are important when using P2RY2 in disease models of allergic airway inflammation?

When employing P2RY2 in disease models, particularly allergic airway inflammation, several critical methodological considerations must be addressed:

  • Selection of Appropriate Disease Model: Choose between acute versus chronic models based on research questions. The house dust mite (HDM)-driven model offers advantages over ovalbumin-alum models due to its clinical relevance and lack of requirement for artificial adjuvants .

  • Cell-Type Specific Targeting Strategies: Implement conditional knockout systems using specific promoters:

    • Cct-cre for epithelial cell-specific deletion (primarily in proximal conducting airways)

    • Vav-cre for hematopoietic and endothelial cell targeting

    • LysM-cre for myeloid lineage cells

    • CD11c-cre for conventional dendritic cells

    • CD4-cre for T-cell specific deletion

  • Comprehensive Phenotypic Analysis: Assess multiple parameters of allergic inflammation:

    • Bronchoalveolar lavage (BAL) for inflammatory cell infiltration

    • Lung histology for tissue inflammation and remodeling

    • Cytokine/chemokine profiling of lung homogenates

    • Airway hyperresponsiveness measurements

    • IgE quantification in serum

  • Validation of Knockout Efficiency: Confirm cell-type specific deletion efficiency using combined approaches:

    • qPCR for mRNA expression

    • Immunohistochemistry for protein expression

    • Functional assays (e.g., calcium responses to ATP/UTP)

  • Control for Developmental Compensation: Include acute pharmacological inhibition experiments alongside genetic approaches to distinguish between developmental compensation effects and acute P2RY2 inhibition outcomes .

These methodological considerations ensure robust experimental design and reliable interpretation of P2RY2's role in allergic airway inflammation.

What are the most promising therapeutic applications for P2RY2 modulators in inflammatory diseases?

The therapeutic potential of P2RY2 modulators in inflammatory diseases encompasses several promising avenues:

  • Allergic Airway Diseases: Studies using conditional knockout models have demonstrated that targeting P2RY2 in specific cell types (epithelial cells, dendritic cells, and myeloid cells) alleviates allergic airway inflammation. This suggests that selective P2RY2 antagonists could represent a novel therapeutic approach for asthma and related conditions .

  • Targeted Delivery Strategies: The accessibility of airway epithelium offers unique opportunities for inhaled therapies. RNA-based therapeutics (such as miRNAs targeting P2RY2) delivered via inhalation could enable rapid and targeted uptake by epithelial cells directly involved in driving airway inflammation, potentially reducing systemic side effects .

  • Cell-Type Selective Approaches: Research indicates differential contributions of P2RY2 depending on cell type, with epithelial, dendritic cell, and myeloid cell expression being pro-inflammatory in allergic contexts. This suggests that developing delivery systems that preferentially target these specific cell populations could optimize therapeutic efficacy .

  • Balancing Beneficial and Harmful Effects: When designing therapeutic interventions, researchers must consider that P2RY2 signaling has beneficial effects in certain contexts, including defense against bacterial infections, wound healing promotion, and stimulation of mucociliary clearance. Therefore, targeted rather than systemic approaches may offer the best therapeutic window .

The significant progress in understanding cell-specific roles of P2RY2 in inflammatory diseases opens new possibilities for developing targeted therapeutics with improved efficacy and reduced side effects compared to current treatments.

How can researchers effectively address contradictory findings in P2RY2 research literature?

Navigating contradictory findings in P2RY2 literature requires systematic methodological approaches:

By systematically addressing these factors, researchers can effectively navigate and reconcile seemingly contradictory findings in the P2RY2 literature.

What are the optimal protocols for characterizing calcium signaling mediated by recombinant P2RY2?

Optimal characterization of P2RY2-mediated calcium signaling requires rigorous methodological approaches:

  • Ratiometric Calcium Imaging Protocol:

    • Load cells with fura-2 AM (5 μM) for 30-45 minutes at room temperature

    • Wash extensively to remove extracellular dye

    • Alternate excitation between 340nm and 380nm wavelengths with emission collection at 510nm

    • Calculate ratio (F340/F380) to determine absolute [Ca²⁺]ᵢ using the equation:
      [Ca²⁺]ᵢ = Kd × (R-Rmin)/(Rmax-R) × (Sf2/Sb2)
      where calibration values are obtained using ionomycin and EGTA

  • Experimental Design for Source Identification:

    • Standard solution: Normal physiological solution containing 2 mM Ca²⁺

    • Ca²⁺-free solution: Replace Ca²⁺ with 1 mM EGTA

    • Store depletion: Apply cyclopiazonic acid (10 μM) in Ca²⁺-free solution

    • Apply sequential challenges with ATP/UTP under these different conditions

  • Pharmacological Dissection Approach:

    • G-protein involvement: Pretreat with pertussis toxin (100 ng/ml, 16-24 hours)

    • PLC pathway: Apply U-73122 (PLC inhibitor) vs. U-73343 (inactive analog)

    • Ryanodine-sensitive stores: Challenge with ryanodine (10 μM) and caffeine (5 mM)

    • IP₃ pathway: Use cell-permeable IP₃ receptor antagonists

  • Combined Electrophysiology and Calcium Imaging:

    • Implement perforated patch whole-cell recordings during fura-2 calcium imaging

    • Hold cells at -60 mV to monitor P2RY2-activated currents

    • Correlate temporal relationship between calcium signals and membrane currents

These methodological approaches provide comprehensive characterization of the calcium signaling dynamics mediated by recombinant P2RY2, enabling researchers to dissect specific pathway components involved in receptor signaling.

What considerations are important when designing gene knockout strategies for P2RY2 in different model systems?

Designing effective gene knockout strategies for P2RY2 requires careful planning and consideration of several key factors:

  • Selection of Targeting Strategy:

    • Global knockout: Useful for initial phenotypic characterization but may mask cell-type specific effects

    • Conditional knockout: Essential for resolving cell-type specific contributions using Cre-loxP system

    • Inducible knockout: Valuable for distinguishing between developmental and acute effects of gene deletion

  • Design of Conditional Alleles:

    • Target critical exons that encode functional domains

    • For P2RY2, insertion of loxP sites flanking critical exons (e.g., intron 2 location as described in the literature) ensures effective disruption of receptor function upon Cre-mediated recombination

  • Cre Driver Selection Based on Research Questions:

    Cre DriverTarget CellsAdvantagesLimitations
    Cct-creEpithelial cells (proximal airways)Targets interface with external environmentLimited to Clara cell secretory protein-expressing cells
    Vav-creHematopoietic and endothelial cellsBroad coverage of immune compartmentNon-specific within hematopoietic lineage
    LysM-creMyeloid lineageTargets key inflammatory cellsSome activity in epithelial cells may confound interpretation
    CD11c-creConventional dendritic cellsFocuses on professional antigen-presenting cellsVariable efficiency in some DC populations
    CD4-creCD4+ T cellsSpecific for T helper cell populationsActivated after thymic selection
  • Validation Requirements:

    • Genomic PCR to confirm recombination

    • RT-PCR to verify transcript reduction

    • Protein detection methods to confirm absence of functional protein

    • Functional assays to demonstrate loss of receptor activity

  • Control Considerations:

    • Include Cre-positive, flox-negative controls to account for Cre toxicity

    • Use flox-positive, Cre-negative controls as true wild-type equivalents

    • Consider mosaic expression of Cre in interpretation of results

Careful consideration of these factors ensures generation of valid and interpretable knockout models for studying P2RY2 function in different experimental contexts.

What are the emerging research directions for P2RY2 in inflammatory disease mechanisms?

Current evidence points to several promising future research directions for P2RY2 in inflammatory diseases:

  • Epithelial-Immune Cell Crosstalk: Future studies should focus on how P2RY2 mediates communication between epithelial cells and immune cells during initiation and progression of inflammatory responses. Recent evidence suggests that epithelial P2RY2 may trigger downstream immune activation through release of danger signals and cytokines .

  • RNA-Based Therapeutic Development: The accessibility of airway epithelium makes P2RY2 an attractive target for RNA-based therapeutics delivered via inhalation. Studies have shown efficient uptake of fluorescently conjugated antagomirs specifically by airway epithelium compared to other cell populations, suggesting this could be a viable therapeutic approach .

  • Resolution Phase Investigation: While the role of P2RY2 in initiating inflammation is becoming clearer, its potential involvement in resolution phases remains poorly understood. Future research should examine whether P2RY2 signaling transitions from pro-inflammatory to pro-resolving functions depending on disease stage .

  • Combination Targeting Strategies: Investigating the effects of combined targeting of P2RY2 in multiple cell types simultaneously could reveal synergistic therapeutic benefits that exceed those observed with cell-type specific approaches alone .

  • Biomarker Development: Research into whether P2RY2 expression levels or activation status could serve as biomarkers for inflammatory disease progression or treatment response represents another valuable direction .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.