Recombinant Cricetulus griseus P2Y purinoceptor 4 (P2RY4)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant P2RY4 is optimized for research applications:

  • Expression Systems: Mammalian cell lines (e.g., HEK293) are preferred for proper post-translational modifications, while E. coli systems offer cost-effective production .

  • Tagging: Often fused with tags like His for purification via affinity chromatography .

  • Quality Control: Rigorous validation via SDS-PAGE, ligand-binding assays, and functional studies (e.g., calcium flux assays) .

Functional and Pharmacological Profile

P2RY4 is a UTP-preferring receptor with distinct signaling properties:

Key Agonists and Antagonists

Agonist/AntagonistActivitySource
UTPPrimary agonist (EC₅₀ ≈ 1–10 µM)
ATPPartial agonist (lower potency than UTP)
SuraminWeak antagonist (IC₅₀ > 100 µM)
PPADSModerate antagonist (IC₅₀ ~10–50 µM)

Biophysical Properties

  • Calcium Permeability: P2RY4 activation induces intracellular Ca²⁺ mobilization, critical for downstream signaling .

  • Allosteric Modulation: Monovalent cations (e.g., Na⁺) and d-tubocurarine enhance ATPγS binding, suggesting allosteric binding sites .

Research Applications

Recombinant P2RY4 is utilized in:

  • Ligand-Binding Studies: Radiolabeled [³⁵S]ATPγS binding assays reveal kinetic and allosteric modulation profiles .

  • Drug Discovery: Screening for modulators targeting inflammatory or metabolic disorders linked to purinergic signaling .

  • Structural Biology: Mapping extracellular domains critical for ligand specificity using chimeric constructs .

Comparative Insights

  • Species Specificity: Human and rat P2RY4 share 87% homology but differ in antagonist sensitivity (e.g., suramin IC₅₀: human ≈ 0.5 mM vs. rat ≈ 100 µM) .

  • Lysosomal Trafficking: Unlike P2X4 receptors, P2RY4 primarily localizes to the plasma membrane but may internalize via clathrin-dependent pathways .

Challenges and Future Directions

  • Low Antagonist Potency: Poor pharmacological tools limit functional studies .

  • Therapeutic Potential: Roles in neuroinflammation, mast cell degranulation, and immune responses warrant further exploration .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please include your desired format in your order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are typically shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we suggest centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please let us know, and we will prioritize development with your specified tag.
Synonyms
P2RY4; P2Y purinoceptor 4; P2Y4; P2Y4 metabotropic purinergic receptor; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
Target Names
Target Protein Sequence
SDTLYVLSLPTLVYYYAARNHWPFGTGFCKFVRFLFYWNLYCSVLFLTCISVHRYMGICH PLRALRWGRPRFASLLCLAVWLVVAGCLVPNLFFVTTSPNGTTILCHDTTRPEEFDHYVH FSSAVMVLLFGLPFLVTLVCYGLMARRLYRPLPGAGQSSSRLRSL
Uniprot No.

Target Background

Function
Receptor for UTP and UDP coupled to G-proteins that activate a phosphatidylinositol-calcium second messenger system.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is P2RY4 and what is its basic molecular structure?

P2RY4 is a purinergic receptor that belongs to the G-protein-coupled receptor family. In humans, the P2RY4 gene is located in the q13 region of the X chromosome and consists of one exon encoding a 365-amino acid protein . The protein structure includes multiple transmembrane domains with important functional regions, particularly the second extracellular loop which contributes significantly to ligand specificity and activity. This loop has been identified as a major determinant of agonist versus antagonist activity in different species homologs .

How does P2RY4 signaling differ between species?

Species differences in P2RY4 function are significant and should be considered when designing experiments. In humans, P2RY4 functions primarily as a UTP receptor, while in mice and rats it is activated by both ATP and UTP . This difference is particularly important when the receptor encounters ATP - in humans, ATP can act as an antagonist to the receptor, whereas in rodents it serves as a full agonist . The structural basis for this difference has been mapped to the second extracellular loop; when this region from the rat receptor replaces the corresponding human sequence, ATP becomes fully agonistic toward the resulting chimeric receptor .

What expression systems are most effective for recombinant P2RY4 production?

For functional studies of recombinant P2RY4, researchers frequently use mammalian expression systems such as HEK-293 cells. These cells allow proper post-translational modifications and membrane trafficking of the receptor. For analyzing mutations like the N178T variant, constructing GFP-tagged receptors in vectors such as pEGFPN1 has proven effective for visualization and functional comparison . When comparing wild-type and mutant receptors, matched expression levels should be verified using techniques such as fluorescent imaging or Western blotting to ensure fair comparison of functional responses.

What are the recommended protocols for generating functional P2RY4 mutants?

To generate functional P2RY4 mutants for comparative studies:

  • Amplify the P2RY4 gene from genomic DNA using specific primers that flank the open reading frame

  • Introduce mutations using site-directed mutagenesis techniques

  • Generate expression constructs by inserting the mutated sequence into appropriate vectors

  • For visualization studies, create GFP-fusion constructs by inserting the GFP coding sequence in frame with the P2RY4 coding sequence

  • Transfect the constructs into appropriate cell lines (e.g., HEK-293 or 1321N1)

  • Verify expression using imaging techniques or Western blotting

  • Conduct functional assays to assess receptor activity

For instance, researchers successfully generated N178T P2RY4-GFP constructs by inserting a HindIII restriction site directly upstream of the stop codon, allowing in-frame fusion with GFP in a pEGFPN1 vector .

What functional assays best measure P2RY4 activity in cellular models?

The following assays are recommended for measuring P2RY4 activity:

  • Calcium mobilization assays: Since P2RY4 couples to Gq proteins, calcium flux measurements using fluorescent indicators can directly measure receptor activation

  • Inositol phosphate accumulation: Measuring IP3 generation following receptor stimulation

  • Membrane localization studies: Using fluorescently-tagged receptors to monitor trafficking to the plasma membrane

  • Agonist/antagonist response curves: Comparing EC50/IC50 values for various ligands

  • Receptor internalization assays: To measure desensitization kinetics

When comparing wild-type and mutant receptors like N178T, it's essential to establish full dose-response curves for both UTP and ATP stimulation. Research has shown that the N178T variant exhibits reduced function in response to both nucleotides in stable cell lines .

How can researchers effectively design in vivo studies with P2RY4 knockout models?

When designing studies with P2RY4 knockout models:

  • Consider species differences in P2RY4 function when translating findings between animal models and humans

  • Use littermate controls to minimize genetic background variations

  • Design experiments to test specific hypotheses about P2RY4 function, such as:

    • Glucose tolerance tests to assess metabolic function

    • Ischemia-reperfusion models to evaluate cardiovascular protection

    • Double-knockout approaches to investigate pathway interactions

P2RY4 knockout mice have been valuable in demonstrating the receptor's role in myocardial protection and glucose homeostasis. Studies show these mice have significantly improved glucose tolerance and insulin sensitivity compared to wild-type littermates . The improvement in insulin sensitivity was not observed in the absence of adiponectin, suggesting an important mechanistic interaction .

What is the significance of the N178T variant of P2RY4 in cardiovascular disease?

The N178T variant (rs3745601) represents a loss-of-function mutation in the human P2RY4 receptor and shows significant clinical correlations:

  • It occurs less frequently in coronary artery disease (CAD) patients than in control individuals

  • CAD patients carrying the N178T variant demonstrate:

    • Significantly reduced jeopardy and Gensini cardiac severity scores

    • Lower resting heart rates

    • Reduced plasma levels of N-terminal pro-brain natriuretic peptide (NT-proBNP)

    • Lower fasting plasma glucose concentrations

The N178T substitution affects receptor function through multiple mechanisms:

  • Decreased membrane expression of the receptor

  • Altered structure of the second extracellular loop, which is critical for nucleotide affinity

  • Reduced response to both UTP and ATP stimulation

These findings suggest that loss of P2RY4 function may be cardioprotective, consistent with observations that P2RY4 knockout mice are protected from myocardial infarction .

What is the relationship between P2RY4 and glucose metabolism?

Research reveals important connections between P2RY4 and glucose metabolism:

  • In human studies, the N178T loss-of-function variant is associated with lower fasting plasma glucose levels in coronary patients

  • P2RY4 knockout mice demonstrate:

    • Significantly improved glucose tolerance

    • Enhanced insulin sensitivity compared to wild-type littermates

    • These metabolic improvements disappear in the absence of adiponectin

These findings suggest P2RY4 normally plays a role in regulating glucose homeostasis, possibly through effects on adipose tissue function and adipokine secretion. P2RY4 knockout in mice has been linked to increased adiponectin secretion by adipocytes , which may explain the improved metabolic parameters. This presents P2RY4 antagonists as potential therapeutic targets for treatment of type 2 diabetes.

How might P2RY4 function relate to developmental processes?

While the search results provide limited information on developmental roles, P2RY4 appears to be required for head formation in vertebrates . The developmental functions of P2RY4 may involve regulation of cell signaling during embryogenesis, particularly in neural tissue development. Understanding these developmental functions could provide insights into the broader physiological roles of P2RY4 beyond its established functions in cardiovascular and metabolic regulation.

What strategies should be employed when studying species-specific differences in P2RY4 function?

When investigating species differences in P2RY4:

  • Create chimeric receptors combining domains from different species to map functional determinants

  • Use molecular dynamics simulations to predict structural differences

  • Compare nucleotide binding profiles across species using competitive binding assays

  • Design species-specific pharmacological tools (agonists/antagonists)

  • Employ evolutionary analysis to understand selective pressures on different domains

Research has identified the second extracellular loop as critically important in determining species-specific responses to ATP. In chimeric receptors where this region from the rat P2RY4 replaced the human counterpart, ATP switched from antagonist to full agonist behavior . This approach can be extended to other domains to map complete species-specific functional differences.

How should researchers interpret conflicting data between in vitro and in vivo P2RY4 functions?

When faced with discrepancies between in vitro and in vivo findings:

  • Consider differences in receptor expression levels, which can affect ligand responses

  • Evaluate the influence of the cellular microenvironment on receptor function

  • Account for compensatory mechanisms that may activate in knockout models

  • Examine tissue-specific effects that may not be captured in cell culture

  • Assess differences in experimental conditions that might affect nucleotide stability or receptor activity

For example, ATP has been described as both a partial agonist and an antagonist of human wild-type P2RY4 depending on its membrane expression level . Understanding such context-dependent behaviors is essential for reconciling apparently contradictory findings.

What are the most promising directions for therapeutic targeting of P2RY4?

Based on current research, promising therapeutic directions include:

  • Development of selective P2RY4 antagonists for:

    • Cardioprotection following ischemic events

    • Treatment of insulin resistance and type 2 diabetes

    • Potential applications in inflammatory conditions

  • Genetic screening for P2RY4 variants:

    • The N178T variant could serve as a biomarker for coronary disease risk stratification

    • Combined analysis with other cardiac gene polymorphisms could improve prediction of infarction severity

  • Pathway-specific interventions:

    • Targeting P2RY4-adiponectin interactions for metabolic disorders

    • Modulating P2RY4 activity in specific tissues to minimize side effects

The identification of the cardioprotective loss-of-function N178T polymorphism, coupled with improved insulin sensitivity in P2RY4-deficient mice, provides strong rationale for pursuing P2RY4 antagonism as a therapeutic strategy .

What are the key considerations for designing primers for P2RY4 amplification and sequencing?

When designing primers for P2RY4 analysis:

  • Consider that P2RY4 is a 2.04 kb gene located on the X chromosome with a single exon

  • Design primers that flank the complete open reading frame for full sequence analysis

  • For sequencing the entire gene, use multiple overlapping primers (as demonstrated in the research where six primers A-F were used)

  • Optimize annealing temperatures (60°C has been successfully used)

  • Use high-fidelity polymerases to minimize amplification errors

  • Include appropriate restriction sites if cloning is required

The following table shows an example of primer design strategy based on the research:

Primer PurposeAnnealing TemperatureConsiderations
Full ORF amplification60°CDesign to include flanking regions
SequencingN/AMultiple overlapping primers (6 primers were used)
MutagenesisVariableInclude desired mutation with 15-20 flanking bases

What strategies can address the challenges of studying membrane protein expression and trafficking?

For effective membrane protein analysis:

  • GFP fusion constructs allow visualization of trafficking and quantification of expression levels

  • Membrane fractionation followed by Western blotting can quantify surface expression

  • Surface biotinylation assays can specifically label and quantify cell surface proteins

  • Flow cytometry with antibodies against extracellular epitopes can measure surface expression

  • Live-cell imaging with fluorescently tagged receptors can monitor trafficking dynamics

Researchers successfully used GFP-tagged constructs of WT and N178T P2RY4 transiently transfected into HEK-293 cells to compare expression patterns, using a ZoeTM Fluorescent Cell Imager for analysis . This approach revealed decreased membrane expression of the N178T variant.

How can researchers effectively control for variability in nucleotide degradation when performing P2RY4 functional assays?

Nucleotide stability is critical for reliable P2RY4 assays:

  • Use fresh nucleotide stocks and appropriate storage conditions

  • Include enzyme inhibitors to prevent nucleotide degradation by ectonucleotidases

  • Verify nucleotide purity by HPLC before experiments

  • Include positive controls with stable nucleotide analogs

  • Consider using non-hydrolyzable nucleotide analogs for extended experiments

  • Monitor time-dependent responses that might reflect nucleotide degradation

  • Standardize assay conditions including temperature, pH, and ion concentrations

These approaches help ensure that observed functional differences, such as those between WT and N178T variants, truly reflect receptor properties rather than experimental artifacts caused by variable ligand stability.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.