Recombinant Cricetulus griseus Sterol regulatory element-binding protein 2 (SREBF2)

Shipped with Ice Packs
In Stock
Cat. No.
BT2453905
Source
in vitro E.coli expression system
Synonyms
SREBF2; SREBP2; Sterol regulatory element-binding protein 2; SREBP-2; Sterol regulatory element-binding transcription factor 2
Quick Inquiry

Description

Introduction

Sterol regulatory element-binding protein 2 (SREBF2) is a transcription factor that controls cholesterol homeostasis by stimulating the transcription of sterol-regulated genes . Encoded by the SREBF2 gene, this protein contains a basic helix-loop-helix leucine zipper (bHLH-Zip) domain . SREBF2 regulates genes related to the cholesterol synthesis pathway .

Gene Information and Function

The SREBF2 gene, also known as sterol regulatory element-binding transcription factor 2, is found in humans and Cricetulus griseus (Chinese hamster) . The protein it encodes is a ubiquitously expressed transcription factor . SREBF2 plays a crucial role in maintaining cholesterol homeostasis . It achieves this by binding to the sterol regulatory element 1 (SRE-1) motif and activating the transcription of genes involved in cholesterol biosynthesis .

SREBF2 interacts with INSIG1 and the CREB-binding protein . The SREBF2 gene is associated with diseases such as adrenoleukodystrophy and familial hypercholesterolemia .

Aliases for SREBF2 Gene

  • SRBP2

External IDs for SREBF2 Gene

  • HGNC: 11290

  • NCBI Gene: 6721

  • Ensembl: ENSG00000198911

  • OMIM®: 600481

  • UniProtKB/Swiss-Prot: Q12772

Protein Structure and Function

SREBF2 is synthesized as a precursor protein embedded in the endoplasmic reticulum membrane . Low sterol concentrations trigger the processing of SREBF2, releasing a transcription factor that translocates to the nucleus . This transcription factor then activates the transcription of genes involved in cholesterol biosynthesis .

Role in Disease

Single nucleotide polymorphisms (SNPs) in the SREBF2 gene have been linked to an increased risk of knee osteoarthritis . Furthermore, SREBF2 has been identified as a predictor of incident nonalcoholic fatty liver disease (NAFLD) and diabetes . In colon cancer, SREBF2 regulates lipid metabolism genes, influencing tumor development and patient outcomes .

SREBF2 and Lipid Metabolism Genes in Colon Cancer

In colon cancer, SREBF2 regulates lipid metabolism genes, influencing tumor development and patient outcomes . Studies using machine learning algorithms have identified key genes associated with SREBF2 in colon cancer, including DHCR7, HSD11B2, and RGL1 . High DHCR7 expression is related to poor prognosis in colon cancer .

Interactions

SREBF2 has been shown to interact with :

  • INSIG1

  • CREB-binding protein

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SREBF2; SREBP2; Sterol regulatory element-binding protein 2; SREBP-2; Sterol regulatory element-binding transcription factor 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-482
Protein Length
full length protein
Species
Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
Target Names
SREBF2
Target Protein Sequence
MDESSELGGLETMDTLTELGDELTLGDIDEMLQFVSNQVGEFPDLFSEQLCSSFPGGGSS GSSSSSNSSSSSGSNSRGNGGAATDPGVQRSFSQVPLPTFSPSTASPQALALQVKVSPTP PRATPVLQPRPQPQPQPQPSAQLQQQTVMITPTFSTAPQTRIIQQPLIYQNAATSFQVLQ AQVQSLVTSSQVQPVTIQQQVQTVQAQRVLTQTANGTLQTLAPATVQTVAAPQVQQVPVL VQPQIIKTDSLVLTTLKTDGSPVMAAVQNPALTALTTPLQTGALQVPTLVGSNGTILTTM PVMMGQEKVPIKQVPGGVKQLEPPKEGERRTTHNIIEKRYRSSINDKIIELKDLVMGTDA KMHKSGVLRKAIDYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDSDVDLKIE DFNQNVLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRSRI LL
Uniprot No.
Q60429

Target Background

Function
Sterol regulatory element-binding protein 2 (SREBF2) is a precursor to the transcription factor form, residing within the endoplasmic reticulum membrane. Low sterol concentrations trigger its processing, releasing the transcription factor which translocates to the nucleus and activates transcription of cholesterol biosynthesis genes. As a key transcription factor, SREBF2 regulates the expression of genes involved in cholesterol synthesis. It exhibits dual sequence specificity, binding to both the sterol regulatory element 1 (SRE-1) (5'-ATCACCCCAC-3') and an E-box motif (5'-ATCACGTGA-3'), thereby modulating the transcription of genes within the cholesterol synthesis pathway.
Database Links

KEGG: cge:100689017

Involvement In Disease
Sterol-resistant defective (srd) phenotypes express truncated forms of SREBP-2 protein, often found fused to other proteins, as is the case in SRD-1, where SREBP-2 is fused to an out-of-frame KU p70 protein or, in SRD-2 where the fusion protein is a LIM domain-containing protein. Srd phenotypes are resistant to sterol biosynthesis repression by sterols.
Protein Families
SREBP family
Subcellular Location
[Sterol regulatory element-binding protein 2]: Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein.; [Processed sterol regulatory element-binding protein 2]: Nucleus.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.