Recombinant Cricetulus longicaudatus Peroxisomal biogenesis factor 3 (PEX3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
PEX3; Peroxisomal biogenesis factor 3; Peroxin-3; Peroxisomal assembly protein PEX3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-373
Protein Length
full length protein
Species
Cricetulus longicaudatus (Long-tailed dwarf hamster) (Chinese hamster)
Target Names
PEX3
Target Protein Sequence
MLRSMWNFLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAAEYIAQARRQYHFES NQRTCNMTVLSMLPTLREALMQQLNSESLTALLKNRPSNKLEIWEDLKIISFTRSIVAVY STCMLVVLLRVQLNIIGGYIYLDNATVGKNGTTVLAPPDVQQQYLSSIQHLLGDGLTELV TVIKQAVQRILGSVSLKHSLSLLDLEQKLKEIRILVEQHRSPSWIDKDVSKSSLCQYMMP DEETPLAAQAYGLSPRDITTIKLLNETRDMLESPDFSTVLNTCLNRGFSRLLDNMAEFFR PTEQDLQHGNSINSLSSVSLPLAKIIPIVNGQIHSVCSDTPSHFVQDLLMMEQVKDFAAN VYEAFSTPQQLEK
Uniprot No.

Target Background

Function

Recombinant Cricetulus longicaudatus Peroxisomal biogenesis factor 3 (PEX3) is involved in peroxisome biosynthesis and integrity. It assembles membrane vesicles prior to the translocation of matrix proteins. Functioning as a docking factor for PEX19, PEX3 is crucial for the import of peroxisomal membrane proteins into peroxisomes.

Protein Families
Peroxin-3 family
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of PEX3 in peroxisome biogenesis?

PEX3 functions as a master regulator of peroxisome biogenesis, playing an essential role in the assembly of peroxisomal membrane vesicles. As an integral membrane protein, PEX3 is crucial for the insertion of membrane proteins into the peroxisomal membrane . PEX3 interacts with PEX19, which acts as a receptor for peroxisomal membrane proteins (PMPs), initiating the biogenesis of peroxisome precursors from the endoplasmic reticulum (ER) . This interaction is fundamental to the early stages of peroxisome formation across diverse eukaryotic organisms. Research has demonstrated that in the absence of functional PEX3, proper assembly of peroxisomes is severely compromised, often resulting in complete absence of morphologically recognizable peroxisomes .

What are the key functional domains of PEX3 essential for its activity?

The most critical functional domain of PEX3 is the PEX19-binding region, which contains highly conserved aromatic and hydrophobic residues. Studies have identified specific amino acids that are essential for PEX3-PEX19 interaction across species. In trypanosomal PEX3, phenylalanine 102 (F102) and leucine 105 (L105) are crucial residues, as mutation of these amino acids to alanine abolishes interaction with PEX19 . These correspond to similar conserved residues in other species, such as tryptophan 104 (W104) in human PEX3 . Additionally, PEX3 contains regions required for proper insertion into the ER membrane during the initial stages of peroxisome biogenesis. Research utilizing GFP fusion proteins has demonstrated that PEX3 initially localizes to the ER and nuclear envelope before peroxisome formation , indicating the presence of ER-targeting domains within the protein structure.

What are the most effective methods for studying PEX3-PEX19 protein interactions?

Several complementary approaches have proven effective for investigating PEX3-PEX19 interactions:

Yeast Two-Hybrid (Y2H) Assay: This technique has been extensively used to characterize the interaction between PEX3 and PEX19. In a modified Y2H system, researchers have fused PEX3 to the DNA-binding domain (BD) of the GAL4 transcriptional activator and PEX19 to the activation domain (AD) . The interaction strength can be quantified by measuring reporter gene expression.

In vitro Binding Assays: Pull-down experiments using recombinant proteins provide direct evidence of physical interaction. Typically, MBP (maltose-binding protein) fusions to PEX3 and 6×His-tagged PEX19 are used . The binding can be detected through immunoblotting after pull-down.

Microscale Thermophoresis (MST): This technique allows determination of binding affinities (Kd values) between PEX3 and PEX19 proteins. In this approach, fluorescently labeled PEX19 is titrated with increasing concentrations of PEX3, and the thermophoretic movement of molecules is monitored . The following table summarizes typical experimental conditions:

ParameterTypical Conditions
PEX19 concentration100 nM (NT-647 fluorescently labeled)
PEX3 concentration range0-2.5 μM
Buffer50 mM Tris-HCl pH 7.4, 150 mM NaCl, 10 mM MgCl₂
Temperature25°C

Mutational Analysis: Site-directed mutagenesis of key conserved residues in PEX3 (e.g., F102A, L105A in trypanosomal PEX3) followed by interaction assays provides insights into the specific amino acids essential for PEX3-PEX19 binding .

How can recombinant Chinese hamster PEX3 protein be optimally expressed and purified?

Optimal expression and purification of recombinant Chinese hamster PEX3 requires careful consideration of several factors:

Fusion Tags: Multiple tag options have been used successfully with PEX3 proteins:

  • His-tag for IMAC purification

  • GST-tag for improved solubility and affinity purification

  • MBP-tag for enhanced solubility of hydrophobic regions

  • Fc-Avi double tagging for increased purity and specific applications

Solubilization Strategy: As an integral membrane protein, full-length PEX3 requires detergents for solubilization. Commonly used detergents include n-dodecyl-β-D-maltoside (DDM) or CHAPS at concentrations above their critical micelle concentration.

Purification Protocol: A typical purification workflow includes:

  • Affinity chromatography (based on the fusion tag)

  • Size exclusion chromatography to remove aggregates

  • Optional ion exchange chromatography for increased purity

  • Buffer optimization to maintain stability (often includes 50% glycerol for storage)

Post-purification quality should be assessed by SDS-PAGE (≥85% purity) and functional assays such as PEX19 binding tests .

What are validated methods for tracking PEX3 localization in cellular systems?

Several complementary approaches have been established for tracking PEX3 localization:

Fluorescent Protein Fusions: C-terminal fusion of GFP to PEX3 has been used successfully to monitor its localization in live cells . Studies have shown that during de novo peroxisome formation, PEX3-GFP initially localizes to the ER and nuclear envelope before appearing in nascent peroxisomes.

Indirect Immunofluorescence: For detecting endogenous or epitope-tagged PEX3, researchers have used antibodies against PEX3 or common epitope tags (e.g., HA-tag). This approach allows co-localization studies with peroxisomal markers like aldolase .

Subcellular Fractionation: Biochemical fractionation followed by immunoblotting provides quantitative data on PEX3 distribution across cellular compartments. This technique has confirmed PEX3 co-fractionation with peroxisomal/glycosomal enzymes like aldolase and GAPDH, and to a lesser extent with ER markers like BiP .

Time-course Imaging: To study the dynamics of PEX3 during peroxisome biogenesis, time-lapse imaging of PEX3-GFP in cells has been particularly informative, especially in systems where PEX3 expression can be induced (e.g., using inducible promoters like P₁₀₀₀ in yeast) .

For specific detection of Chinese hamster PEX3, careful antibody validation is necessary, as cross-reactivity between species can vary due to the divergent primary sequence.

How does PEX3 dysregulation contribute to peroxisomal biogenesis disorders?

PEX3 dysfunction has profound implications for peroxisomal disorders:

Zellweger Spectrum Disorders (ZSDs): Mutations in the PEX3 gene typically result in severe, early lethal phenotypes within the Zellweger spectrum . These disorders are characterized by multiple defects in peroxisome function, including impaired β-oxidation of very long-chain fatty acids, defective plasmalogen synthesis, and abnormal bile acid metabolism.

A notable case study reported a patient with compound heterozygous mutations in PEX3 (c.898C>T/p.Arg300* and c.991G>A/p.Gly331Arg) who presented with a milder phenotype than previously reported for PEX3 defects . This indicates that PEX3 mutations can cause a spectrum of disease severity depending on the specific mutations and their impact on protein function.

In peroxisomal biogenesis disorders, cells exhibit defects in the import of peroxisomal matrix proteins into the organelle, which is the cellular hallmark of these conditions. Without functional PEX3, peroxisomal membrane assembly fails, preventing the formation of import-competent peroxisomes .

What makes trypanosomal PEX3 a potential drug target, and how might this inform research on hamster PEX3?

Trypanosomal PEX3 (TbPEX3) has emerged as a promising drug target for several reasons:

Essential for Parasite Viability: Knockdown of TbPEX3 leads to mislocalization of glycosomal enzymes to the cytosol and is lethal to both procyclic and bloodstream forms of Trypanosoma brucei . This absolute lethality indicates that TbPEX3 is an essential gene for trypanosome survival.

Structural Divergence from Human PEX3: The remarkably low sequence identity (approximately 7%) between trypanosomal and human PEX3 provides a basis for selective targeting . This divergence occurs despite functional conservation, particularly in the PEX19-binding domain.

Validated Differential Inhibition: A small molecule screening approach identified compounds that preferentially inhibit the interaction between TbPEX3 and TbPEX19 compared to the human PEX3-PEX19 interaction . One such compound disrupted glycosome biogenesis in T. brucei and was lethal to the parasite at concentrations that had limited effect on human cells.

This approach to studying species-specific PEX3 differences can inform research with Chinese hamster PEX3 by:

  • Providing methodological frameworks for comparative binding studies between species

  • Demonstrating the feasibility of targeting protein-protein interactions despite conserved binding domains

  • Highlighting the importance of secondary structure analysis for proteins with low sequence conservation

What experimental models have been developed to study PEX3 deficiency?

Several experimental models have been established to investigate PEX3 deficiency:

Yeast Models: Saccharomyces cerevisiae pex3Δ mutants have been extensively characterized and show complete absence of peroxisomal structures . Recent studies have challenged the classic view by demonstrating that these cells contain membrane vesicles harboring a subset of peroxisomal membrane proteins, including the receptor docking protein Pex14 .

Mammalian Cell Culture Models: Fibroblasts from Zellweger syndrome patients with PEX3 mutations provide human disease models. Additionally, CRISPR/Cas9-generated PEX3 knockout cell lines have been developed in various mammalian backgrounds.

Conditional Systems: For studying essential genes like PEX3, several conditional approaches have been employed:

  • Tetracycline-inducible RNAi systems in trypanosomes

  • Temperature-sensitive mutants in yeast

  • Inducible expression systems for complementation studies

Functional Complementation: The reintroduction of PEX3 into pex3-deficient cells has been particularly informative. In Hansenula polymorpha pex3 cells, expression of Pex3-GFP under an inducible promoter showed that Pex3 initially localized to the ER and nuclear envelope before peroxisome formation .

How do binding kinetics differ between PEX3-PEX19 interactions across species?

Comparative binding studies have revealed important differences in PEX3-PEX19 interactions across species, which has implications for both basic research and drug development:

Binding Affinity Measurements: Microscale thermophoresis (MST) analysis has been used to determine dissociation constants (Kd) for different PEX3-PEX19 pairs. While specific values for Chinese hamster PEX3 are not explicitly provided in the available literature, studies with trypanosomal and human proteins have demonstrated measurable differences in binding affinity .

Key Residue Requirements: Mutational analysis has revealed both conserved and species-specific requirements for PEX3-PEX19 binding:

SpeciesCritical ResiduesEffect of Mutation
Trypanosomal PEX3F102, L105Complete loss of PEX19 binding
Trypanosomal PEX3L89, Y118No effect on PEX19 binding
S. cerevisiae PEX3W128, L131Complete loss of PEX19 binding
S. cerevisiae PEX3L110, Y144Loss of PEX19 binding
Human PEX3W104, L107Critical for PEX19 binding

What are the methodological considerations for differential screening of compounds targeting PEX3?

The development of assays for differential screening of compounds targeting PEX3 requires careful methodological considerations:

Modified Yeast Two-Hybrid (Y2H) Systems: A key advancement has been the modification of traditional Y2H systems for compound screening. This includes:

  • Using yeast strains with deleted drug efflux pumps (e.g., pdr5Δ) to prevent compound export

  • Establishing parallel systems comparing different species' PEX3-PEX19 pairs

  • Implementing quantitative readouts for interaction strength

Screening Criteria Definition: Successful differential screening requires clear selection criteria. For the trypanosomal vs. human PEX3 screening, compounds were considered selective if they showed:

  • 65% growth inhibition of yeast expressing TbPEX3/TbPEX19

  • <65% growth inhibition of yeast expressing HsPEX3/HsPEX19

  • No growth inhibition in control conditions (to exclude generally toxic compounds)

Secondary Validation Assays: Multiple orthogonal approaches should be used to confirm hit compounds:

  • In vitro binding assays with purified proteins

  • Cellular localization studies to confirm peroxisome biogenesis disruption

  • Species-specific cytotoxicity tests to confirm selectivity

  • Structure-activity relationship studies to optimize lead compounds

Assay Optimization: Parameters including protein expression levels, reporter sensitivity, incubation times, and compound concentrations must be carefully optimized to maximize assay performance and reproducibility.

How does PEX3 function in peroxisome inheritance and what methodologies reveal this role?

Beyond its role in peroxisome biogenesis, PEX3 has been implicated in peroxisome inheritance, with specialized methodologies revealing this function:

Genetic Approaches: Studies in yeast have identified a specific role for PEX3 in peroxisome inheritance through the creation and analysis of pex3 mutants. Notably, in S. cerevisiae, two PEX3 genes (PEX3A and PEX3B) have been identified, with PEX3B specifically involved in peroxisome inheritance .

Time-lapse Microscopy: Long-term imaging of cells expressing fluorescently-tagged peroxisomal markers has been instrumental in documenting peroxisome inheritance patterns in wild-type versus pex3-mutant cells. In pex3BΔ yeast cells, abnormal peroxisome morphology (hyperelongated, tubular-reticular peroxisomes) was observed over time, with the percentage of cells containing elongated peroxisomes increasing to >90% after 10 hours of growth in oleic acid-containing medium .

Protein-Protein Interaction Studies: Beyond its interaction with PEX19, PEX3 has been identified as a receptor for class V myosin motor proteins, which are required for organelle transport into daughter cells during cell division . This function represents a fascinating connection between peroxisome biogenesis and inheritance mechanisms.

Quantitative Morphological Analysis: Detailed analysis of peroxisome number, size, and distribution in wild-type versus pex3-mutant cells has revealed that peroxisome number in pex3BΔ cells varied widely, from as few as 1-2 peroxisomes per cell to numbers comparable to wild-type cells . These quantitative approaches are essential for characterizing subtle phenotypes related to peroxisome inheritance.

What are the emerging technologies that could advance PEX3 structural and functional studies?

Several cutting-edge technologies show promise for advancing PEX3 research:

Cryo-Electron Microscopy (Cryo-EM): This technique could resolve the complete structure of PEX3 in complex with PEX19 and potentially other interacting partners. Cryo-EM is particularly valuable for membrane proteins like PEX3 that are challenging to crystallize.

AlphaFold and Other AI-Based Structure Prediction: The recent advancements in protein structure prediction through artificial intelligence could help model species-specific PEX3 structures, particularly for divergent orthologs like trypanosomal PEX3 that share minimal sequence identity with characterized PEX3 proteins.

Proximity Labeling Proteomics: Techniques such as BioID or APEX2 proximity labeling fused to PEX3 could identify novel interacting proteins in the vicinity of PEX3 during different stages of peroxisome biogenesis.

Single-Molecule Imaging: Advanced microscopy techniques could track individual PEX3 molecules during peroxisome formation, providing insights into the dynamics of this process with unprecedented resolution.

CRISPR-Based Screening: Genome-wide CRISPR screens in the presence of PEX3 inhibitors could identify synthetic lethal interactions and resistance mechanisms, informing both basic biology and therapeutic approaches.

How might PEX3 function differ in specialized peroxisome-like organelles across species?

PEX3 function shows interesting adaptations across specialized peroxisome-like organelles:

Glycosomes in Trypanosomatids: In trypanosomatid parasites, PEX3 plays an essential role in the biogenesis of glycosomes, which are specialized peroxisomes that compartmentalize glycolytic enzymes . This compartmentalization is essential for parasite viability, making TbPEX3 a potential therapeutic target.

Woronin Bodies in Filamentous Fungi: These specialized peroxisome-derived organelles seal septal pores upon cellular damage. Research into PEX3's role in Woronin body formation could reveal adaptations of the peroxisome biogenesis machinery for this specialized function.

Glyoxysomes in Plants: These peroxisomes are specialized for the glyoxylate cycle and gluconeogenesis from lipids. The role of plant PEX3 in the transition between different peroxisome types represents an area for future investigation.

Species-Specific Differences in Peroxisome Formation: The mechanisms of peroxisome formation appear to vary between species. In some organisms, peroxisomes form de novo from the ER, while in others, they primarily multiply by division of pre-existing peroxisomes. How PEX3 functions may differ in these contexts remains to be fully elucidated.

Comparative studies using recombinant PEX3 from diverse species, including Chinese hamster, could help unravel these specialized adaptations of a conserved peroxisome biogenesis factor.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.