Recombinant Cricetulus longicaudatus Peroxisome assembly protein 12 (PEX12)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
PEX12; Peroxisome assembly protein 12; Peroxin-12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
full length protein
Species
Cricetulus longicaudatus (Long-tailed dwarf hamster) (Chinese hamster)
Target Names
PEX12
Target Protein Sequence
MAEHGAHITTASVVDDQPSIFEVVAQDSLMTAVRPALQHVVKVLAESNPAHYGFFWRWFD EIFTLLDFLLQQHYLSRTSASFSEHFYGLKRIVAGSSQQPQRPASAGLPKEHLWKSTMFL VLLPYLKVKLEKLASSLREEDEYSIHPPSSHWKRFYRAFLAAYPFVNMAWEGWFLTQQLR YILGKAEHHSPLLKLAGVRLGRLTAQDIQAIEHRLSEASVMQDPVRSVGEKIKLALKKAV GGIALSLSTGLSVGVFFLQFLDWWYSSENQETIKSLTALPTPPPPVHLDYNSDSPLLPKM KTVCPLCRKTRVNDTVLATSGYVFCYRCVFNYVRSHQACPITGYPTEVQHLIKLYSPEN
Uniprot No.

Target Background

Function
Essential for protein import into peroxisomes.
Protein Families
Pex2/pex10/pex12 family
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein.

Q&A

What is Cricetulus longicaudatus PEX12 and what role does it play in peroxisome biogenesis?

Cricetulus longicaudatus (Chinese hamster) PEX12 is an integral peroxisomal membrane protein essential for peroxisome biogenesis. It belongs to the peroxin family of proteins that are critical for the assembly of functional peroxisomes . PEX12 contains a zinc ring domain at its carboxy terminus that plays a crucial role in its function .

In peroxisome biogenesis, PEX12 specifically participates in the import of matrix proteins into peroxisomes. It functions downstream of the receptor docking event in the protein import pathway . When PEX12 is defective or absent, both PTS1 (Peroxisome Targeting Signal type 1) and PTS2-dependent protein transport to peroxisomes is impaired , resulting in abnormal peroxisome assembly and function.

What are the key structural domains of C. longicaudatus PEX12 and how do they compare to human PEX12?

The key structural domains of C. longicaudatus PEX12 include:

  • Transmembrane segments: PEX12 contains two primary transmembrane segments that anchor it to the peroxisomal membrane . More recent structural studies have revealed that PEX12 actually contains five transmembrane segments, many of which were previously missed in predictions due to their hydrophilicity .

  • RING finger domain (zinc binding domain): Located at the C-terminus and exposed to the cytosol, this domain is critical for PEX12's function in protein import . The zinc finger motif enables specific protein-protein interactions.

  • N-terminal region: The N-terminal part is also oriented toward the cytosol and is essential for localization to peroxisomes and biological function .

Comparison with human PEX12:

  • The human PEX12 shares significant structural homology with C. longicaudatus PEX12, especially in the functionally important zinc binding domain

  • Both proteins contain conserved cysteine residues essential for zinc binding in the RING domain

  • The rat PEX12, which is closely related to Chinese hamster PEX12, encodes a 359-amino-acid membrane protein compared to human PEX12's 366 amino acids

How is PEX12 expression regulated at the cellular level?

PEX12 expression regulation involves several mechanisms:

  • Transcriptional regulation: Though specific data for C. longicaudatus is limited, studies suggest peroxin genes respond to metabolic demands requiring peroxisomal function

  • Post-translational modifications: PEX12 function is regulated through:

    • Interaction with the ubiquitin ligase complex components (PEX2, PEX10)

    • Phosphorylation events that may modulate protein-protein interactions

  • Protein complex formation: PEX12 functions in coordination with PEX10 and PEX2 to form a membrane-embedded ubiquitin ligase complex . This complex formation is critical for its role in peroxisomal protein import.

  • Regulated degradation: Like other peroxins, PEX12 levels are controlled through targeted degradation pathways to maintain peroxisome homeostasis .

What methods are most effective for cloning and expressing recombinant C. longicaudatus PEX12?

Recommended cloning and expression methods:

  • cDNA isolation approach:

    • RT-PCR from C. longicaudatus total RNA using specific primers targeting conserved regions of PEX12

    • Functional complementation assay of peroxisome-deficient mutant CHO cell lines (such as ZP109)

  • Expression vector selection:

    • Mammalian expression vectors with strong promoters (CMV, EF1α)

    • For bacterial expression, codon optimization is strongly recommended due to differences between hamster and bacterial codon usage

  • Expression systems:

    • Mammalian cells: CHO cells provide an ideal homologous system for expressing C. longicaudatus PEX12

    • Insect cells: Baculovirus expression system for higher yields of properly folded protein

    • Cell-free systems: When studying specific domains like the zinc finger region

  • Expression verification methods:

    • Western blotting with anti-PEX12 antibodies or epitope tag antibodies

    • Functional complementation assays in PEX12-deficient cell lines

    • Green fluorescent protein (GFP) fusion constructs to visualize proper peroxisomal localization

How can I validate the functionality of recombinant C. longicaudatus PEX12 in cellular systems?

Functional validation approaches:

  • Complementation assays:

    • Transfect recombinant PEX12 into PEX12-deficient cell lines (such as human or hamster cells with PEX12 mutations)

    • Assess restoration of peroxisome biogenesis using the following parameters:

    Assay TypeMethodologyExpected Result
    Matrix protein importImmunofluorescence for catalase or other peroxisomal enzymesShift from cytosolic to punctate peroxisomal pattern
    PTS1 protein importGFP-SKL reporter protein localizationRestoration of peroxisomal targeting
    PTS2 protein importImmunofluorescence for thiolaseRestoration of peroxisomal targeting
    Biochemical functionCatalase enzyme activity/latencyIncreased enzyme compartmentalization
    Ultrastructural analysisElectron microscopyPresence of morphologically normal peroxisomes
  • Protein interaction studies:

    • Co-immunoprecipitation with known PEX12 interaction partners (PEX5, PEX10)

    • Two-hybrid assays to assess interaction with other peroxins

    • Blot overlay assays specifically for the zinc-binding domain interactions

  • Peroxisomal membrane localization:

    • Differential permeabilization with digitonin and Triton X-100

    • Subcellular fractionation followed by Western blotting

    • Indirect immunofluorescence microscopy with peroxisomal membrane markers

What experimental approaches can be used to investigate the specific interactions between PEX12 and other peroxins?

Protein interaction investigation methods:

  • In vitro binding assays:

    • GST pull-down assays with purified PEX12 domains and interaction partners

    • Surface plasmon resonance (SPR) to measure binding kinetics

    • ELISA-based interaction assays for quantitative measurements

  • In vivo interaction studies:

    • Yeast two-hybrid assays: Particularly effective for mapping interaction domains

    • Split-GFP complementation assays in mammalian cells

    • FRET/BRET assays to detect protein-protein interactions in living cells

  • Mutational analysis approach:

    • Site-directed mutagenesis of key residues, particularly in the zinc-binding domain

    • Comparison of wild-type versus patient-derived mutations (e.g., S320F mutation)

    • Domain deletion constructs to map interaction regions

  • Crosslinking studies:

    • Chemical crosslinking followed by mass spectrometry to identify interacting partners

    • In-cell crosslinking to capture transient interaction complexes

  • Structural studies:

    • Cryo-electron microscopy of the peroxisomal membrane protein complexes

    • NMR studies of isolated domains, particularly the zinc-binding domain

How do mutations in PEX12 affect its interactions with PEX5 and PEX10, and what are the implications for peroxisome assembly?

Mutations in PEX12 can significantly disrupt its interactions with PEX5 and PEX10, with profound implications for peroxisome assembly:

Impact on protein interactions:

  • PEX12-PEX5 interaction:

    • The zinc-binding domain of PEX12 directly binds the PTS1 receptor PEX5

    • The S320F missense mutation in the PEX12 zinc-binding domain reduces binding to PEX5

    • This interaction appears critical for a step after receptor docking, as loss of PEX12 does not prevent PEX5 association with peroxisomes but blocks matrix protein import

    • PEX5 becomes abnormally trapped at the peroxisomal membrane in PEX12-deficient cells

  • PEX12-PEX10 interaction:

    • PEX12 forms an extensive interface with PEX10 through their respective RING finger domains

    • The S320F mutation also reduces PEX12 binding to PEX10

    • The RF10-RF12 complex functions as a unit in the polyubiquitylation pathway

    • This interaction is structurally essential for forming a stable membrane-embedded ubiquitin ligase complex

  • Functional suppression evidence:

    • Overexpression of either PEX5 or PEX10 can suppress some PEX12 mutations, providing genetic evidence that these interactions are biologically relevant

Implications for peroxisome assembly:

  • Import pathway disruption:

    • Different mutations in PEX12 can result in varying degrees of import deficiency

    • Mutations affecting zinc binding (e.g., C354S) completely abolish peroxisomal protein import

    • Mutations in the N-terminal region (e.g., R34S) cause milder phenotypes with mosaic catalase immunofluorescence

  • Distinct roles in ubiquitination pathways:

    • PEX12, together with PEX10, participates in the polyubiquitylation pathway that regulates the degradation of import receptors when recycling is compromised

    • This polyubiquitylation pathway maintains the homeostasis of multiple peroxisomal import factors, including PEX5, PEX9, PEX18, and components of receptor docking complexes

  • Genotype-phenotype correlations:

    • Severity of PEX12 mutations correlates with disease phenotypes, ranging from severe Zellweger syndrome to milder peroxisomal biogenesis disorders

    • Some patients with seemingly severe mutations can display unexpectedly mild phenotypes due to mechanisms like translation initiation at internal AUG codons

What is the role of PEX12 in the ubiquitin-dependent regulation of peroxisomal protein import?

PEX12 plays a central role in the ubiquitin-dependent regulation of peroxisomal protein import through several mechanisms:

  • Structure of the peroxisomal ubiquitin ligase complex:

    • PEX12 forms part of a membrane-embedded ubiquitin ligase complex with PEX2 and PEX10

    • This complex forms a channel with their transmembrane segments and a cytosolic tower with their ring finger domains

    • Each protein has five transmembrane segments that form a triangular shape in the membrane

    • The ring finger tower consists of RF2 (PEX2), RF10 (PEX10), and RF12 (PEX12)

  • Dual ubiquitination pathways:

    • Monoubiquitylation pathway:

      • Normal receptor recycling predominantly involves RF2 (PEX2)

      • This pathway allows for recycling of receptors like PEX5 back to the cytosol for additional rounds of import

    • Polyubiquitylation pathway:

      • Mediated by RF10 (PEX10) and RF12 (PEX12) working as a functional unit

      • Activated when the normal recycling pathway is compromised

      • Targets receptors for degradation via the RADAR (Receptor Accumulation and Degradation in the Absence of Recycling) pathway

      • Also regulates homeostasis of other peroxisomal import factors beyond receptors

  • Molecular mechanism:

    • RF10 (PEX10) and RF12 (PEX12) have an extensive interface (~450 Ų) mediated by conserved hydrophobic residues

    • L398 of PEX12 interacts with ubiquitin during the polyubiquitylation process

    • Mutations designed to abolish E2 binding (L288A or R324A in PEX10) or disrupt the interaction with RF12 (L270A) significantly reduce ubiquitin ligase activity

    • PEX12 stimulates the ubiquitin ligase activity of PEX10

  • Receptor dynamics regulation:

    • In wild-type cells, PEX5 is primarily cytosolic

    • In cells with defective PEX1, PEX5 becomes trapped at the peroxisome membrane

    • PEX12 functions to remove PEX5 from the peroxisome membrane for additional rounds of import

How can recombinant C. longicaudatus PEX12 be used as a tool to study peroxisome biogenesis disorders?

Recombinant C. longicaudatus PEX12 can serve as a valuable research tool for studying peroxisome biogenesis disorders (PBDs) through several applications:

  • Cell-based disease modeling:

    • Create mutant PEX12 constructs mimicking patient mutations to study their effects on peroxisome assembly

    • Develop stable cell lines expressing various PEX12 mutations as cellular models of different PBD phenotypes

    • Use in complementation studies to classify patient cell lines into appropriate complementation groups

  • Structure-function relationship studies:

    • Map critical functional domains through systematic mutagenesis

    • Identify residues essential for specific protein interactions

    • Compare the effects of equivalent mutations across species to understand evolutionary conservation of function

    DomainCritical ResiduesFunctionAssociated Pathogenic Mutations
    N-terminalR34Peroxisomal localizationR34S (mild phenotype)
    TransmembraneMultipleMembrane anchoring, complex formationVarious (affect complex stability)
    RING/Zinc fingerC354, othersProtein interactions, ubiquitinationC354S (severe phenotype), S320F
  • Therapeutic approach development:

    • Screen for compounds that might improve folding/function of mutant PEX12 proteins

    • Test gene therapy approaches using recombinant PEX12:

      • Compare AAV-mediated delivery of PEX12 to AAV-mediated PEX1 delivery, which has shown promise in improving visual function in a mouse model of Zellweger spectrum disorder

      • Evaluate targeting efficiency to peroxisomal membranes

  • Genotype-phenotype correlation studies:

    • Use C. longicaudatus PEX12 variants to create an allele severity spectrum similar to studies done with PEX2 and PEX16

    • Compare the ability of various mutant forms to rescue peroxisome assembly in PEX12-deficient cells

    • Understand why some severe mutations (like early truncations) sometimes result in unexpectedly mild clinical phenotypes due to mechanisms like internal translation initiation

  • Cross-species peroxisome biogenesis comparison:

    • Leverage the conservation between C. longicaudatus and human PEX12 for comparative studies

    • Test functional interchangeability of PEX12 proteins across species (similar to "humanized" Drosophila studies with PEX2 and PEX16)

    • Identify species-specific aspects of peroxisome assembly that may inform evolutionary adaptations

How do you interpret contradictory functional data when studying PEX12 mutations?

Interpreting contradictory functional data for PEX12 mutations requires systematic analysis of experimental variables and careful consideration of molecular mechanisms:

  • Methodological considerations:

    • Cell type differences: Results from CHO cells may differ from human fibroblasts due to species-specific interactions

    • Assay sensitivity variations: Different assays for peroxisome function have varying sensitivity thresholds

    • Expression level effects: Overexpression may mask defects or create artificial interactions

    • Temperature effects: Some mutations show temperature-sensitive phenotypes; experiments at 37°C vs. 40°C may yield different results

  • Molecular mechanisms explaining contradictions:

    • Alternative translation initiation: Some seemingly severe mutations in early coding regions may allow translation from downstream AUG codons, producing partially functional proteins

    • Genetic suppression: Overexpression of interaction partners (PEX5 or PEX10) can suppress certain PEX12 mutations, potentially explaining why some mutations appear less severe in particular experimental contexts

    • Phenotypic mosaicism: Some PEX12 mutations (like R34S) result in a mosaic pattern of catalase immunofluorescence that persists even at elevated temperatures, complicating interpretation

  • Systematic approach for resolution:

    • Multiple assay validation: Assess peroxisome function using multiple independent assays:

      • PTS1 import (e.g., GFP-SKL localization)

      • PTS2 import (e.g., thiolase localization)

      • Catalase latency/biochemical enzyme compartmentalization

      • Peroxisome morphology (EM studies)

    • Domain-specific functional analysis: Test specific aspects of PEX12 function:

      • Membrane localization

      • Protein-protein interactions

      • Ubiquitin ligase activity

    • Combined in vitro and in vivo approaches: Correlate biochemical binding data with cellular phenotypes

  • Case study: Resolving contradictions in mutation severity

    • The PEX12 c.26,27Δ mutation appears severe (2-bp deletion early in the coding region) but results in a mild clinical phenotype

    • Functional complementation assays revealed significant PEX12 activity

    • Further investigation showed expression of a 29-kD PEX12 protein due to translation initiation at a downstream AUG codon

    • This exemplifies how apparent contradictions may be resolved through deeper molecular investigation

What analytical approaches can be used to evaluate the relationship between PEX12 mutations and disease severity?

Several analytical approaches can help establish correlations between PEX12 mutations and disease severity:

How can advanced imaging techniques be optimized for studying PEX12 localization and dynamics?

Advanced imaging techniques can be optimized for PEX12 studies through several strategic approaches:

  • Fluorescent protein fusion strategies:

    • Terminal tag placement considerations:

      • C-terminal tags may interfere with the critical zinc-binding domain

      • N-terminal tags could disrupt peroxisomal targeting

      • Internal tagging at permissive sites identified through structural analysis

    • Tag selection optimization:

      • Small monomeric tags (mNeonGreen, mScarlet) to minimize functional interference

      • Split fluorescent protein approaches for interaction studies

      • Self-labeling protein tags (SNAP, CLIP, Halo) for flexible labeling options

  • Super-resolution microscopy applications:

    • STED microscopy: Visualize PEX12 distribution within the peroxisomal membrane

    • STORM/PALM: Map precise locations of PEX12 relative to other peroxins at nanoscale resolution

    • SIM: Characterize peroxisome morphology changes in cells with mutant PEX12

  • Live-cell imaging optimization:

    • Photoactivatable/photoconvertible probes: Track newly synthesized PEX12 trafficking to peroxisomes

    • FRAP analysis: Measure PEX12 mobility within the peroxisomal membrane

    • Lattice light-sheet microscopy: Capture dynamic changes in peroxisome morphology with minimal phototoxicity

  • Correlative microscopy approaches:

    • CLEM (Correlative Light and Electron Microscopy): Connect fluorescently labeled PEX12 with ultrastructural peroxisome details

    • Super-resolution with immuno-EM: Precise localization of PEX12 relative to other peroxisomal proteins

  • Multiplexed imaging strategies:

    • Multi-color imaging: Simultaneously track PEX12 with interaction partners (PEX5, PEX10)

    • FRET/BRET sensors: Detect conformational changes or protein interactions in real-time

    • Sequential labeling methods: Map multiple peroxins using multiplexed antibody staining and imaging

  • Quantitative image analysis tools:

    • Machine learning algorithms: Automated detection and classification of peroxisome morphologies

    • Particle tracking: Analyze peroxisome dynamics in relation to PEX12 expression levels

    • Colocalization analysis: Quantify spatial relationships between PEX12 and other peroxisomal proteins

What emerging technologies could advance our understanding of PEX12 function and regulation?

Several emerging technologies hold promise for deepening our understanding of PEX12:

  • CRISPR-based approaches:

    • Base editing and prime editing: Create precise PEX12 mutations without double-strand breaks

    • CRISPRi/CRISPRa: Modulate PEX12 expression levels to study dosage effects

    • CRISPR screens: Identify genetic modifiers that influence PEX12 function

  • Advanced proteomics techniques:

    • Proximity labeling methods (BioID, APEX): Map the PEX12 interactome at the peroxisomal membrane

    • Cross-linking mass spectrometry: Capture transient interaction interfaces

    • Targeted proteomics: Quantify changes in the peroxisomal proteome in response to PEX12 mutations

  • Structural biology innovations:

    • Cryo-electron tomography: Visualize PEX12 in its native membrane environment

    • Integrative structural modeling: Combine multiple structural data types to model the complete PEX2-PEX10-PEX12 complex

    • AlphaFold2/RoseTTAFold: Predict structural impacts of PEX12 mutations with improved accuracy

  • Single-cell technologies:

    • Single-cell transcriptomics: Understand cell-to-cell variability in response to PEX12 mutations

    • Single-molecule imaging: Track individual PEX12 molecules in living cells

    • Digital spatial profiling: Map peroxisome-related gene expression in tissues from PBD models

  • Biomimetic systems:

    • Artificial peroxisome membranes: Reconstitute PEX12 function in defined lipid environments

    • Organoid models: Study PEX12 function in more physiologically relevant 3D tissue contexts

    • Microfluidic organ-on-chip models: Examine PEX12 function under controlled physiological conditions

What strategies can address the challenges in developing therapies for PEX12-related peroxisomal disorders?

Developing therapies for PEX12-related disorders presents unique challenges that can be addressed through innovative strategies:

  • Precision gene therapy approaches:

    • AAV-mediated gene delivery: Similar to successful PEX1 gene augmentation, which improved visual function in a ZSD mouse model

    • Mutation-specific strategies:

      • Antisense oligonucleotides for splicing mutations

      • Base editing for missense mutations

      • Full gene replacement for severe loss-of-function variants

    • Tissue-targeted delivery: Focus on most affected tissues (CNS, liver) to maximize therapeutic impact

  • Small molecule interventions:

    • Protein stabilizers: Identify compounds that enhance stability of mutant PEX12 proteins

    • Molecular chaperones: Enhance folding of partially functional PEX12 variants

    • PPI modulators: Develop compounds that promote PEX12 interaction with its partners

    • Read-through agents: For nonsense mutations that prematurely terminate PEX12 translation

  • Alternative pathway enhancement:

    • Bypass strategies: Identify and enhance alternative peroxisomal import pathways

    • Metabolic interventions: Address downstream metabolic consequences of peroxisomal dysfunction

    • PEX5/PEX10 upregulation: Leverage genetic suppression of certain PEX12 mutations by PEX5 or PEX10 overexpression

  • Model system optimization:

    • Improved disease models: Develop better animal models specific for PEX12 deficiency

    • Patient-derived systems: iPSC-derived organoids from patients with defined PEX12 mutations

    • "Humanized" model organisms: Similar to the PEX2/PEX16 studies in Drosophila , develop models expressing human PEX12 variants

  • Combined therapeutic approaches:

    • Genotype-tailored strategies: Different approaches based on mutation type and mechanism

    • Multi-target therapy: Simultaneously address multiple aspects of peroxisomal dysfunction

    • Life-stage specific interventions: Different therapeutic approaches for developmental vs. degenerative manifestations

How might evolutionary analysis of PEX12 across species inform our understanding of peroxisome biology?

Evolutionary analysis of PEX12 across species can provide valuable insights into peroxisome biology:

  • Functional domain conservation analysis:

    • Compare C. longicaudatus PEX12 with homologs from diverse species to identify:

      • Universally conserved residues critical for core functions

      • Lineage-specific adaptations suggesting specialized roles

      • Rapidly evolving regions that may reflect species-specific interactions

    • Correlate evolutionary conservation with structural features and mutational impact

  • Comparative peroxisome biology insights:

    • Study how PEX12 function varies across:

      • Mammals with different metabolic requirements

      • Model organisms like yeast, plants, and invertebrates

      • Specialized cells with high peroxisome requirements

    • Identify species-specific aspects of peroxisome assembly that may reflect environmental adaptations

  • Phylogenetic distribution of interacting partners:

    • Map co-evolution of PEX12 with its binding partners (PEX5, PEX10)

    • Identify evolutionary constraints on interaction interfaces

    • Understand how the PEX2-PEX10-PEX12 complex evolved as a functional unit

  • Reconciling observations across model systems:

    • Chinese hamster (C. longicaudatus) PEX12 studies provide important insights due to established CHO cell lines

    • Understanding species differences is critical when extrapolating findings:

      • Between model organisms and humans

      • Between different experimental systems

  • Evolutionary medicine applications:

    • Identify naturally occurring variants that confer resistance to peroxisome dysfunction

    • Understand how different species compensate for peroxisomal defects

    • Discover potential therapeutic targets based on evolutionary adaptations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.