Recombinant Cronobacter sakazakii 4-hydroxybenzoate octaprenyltransferase (ubiA)

Shipped with Ice Packs
In Stock

Description

Biochemical Characteristics and Function

The ubiA enzyme facilitates the condensation of 4-HB with an all-trans polyprenyl chain to form 3-octaprenyl-4-hydroxybenzoate (UQ-8 intermediate), a precursor in the ubiquinone biosynthetic pathway . Key features include:

  • Enzyme Class: Transferase (EC 2.5.1.-)

  • Substrate: 4-Hydroxybenzoate (4-HB)

  • Product: 3-Octaprenyl-4-hydroxybenzoate

  • Catalytic Mechanism: Transfer of an octaprenyl group to 4-HB, mediated by a prenyltransferase active site .

This reaction is indispensable for maintaining bacterial membrane integrity and energy metabolism, particularly in pathogens like C. sakazakii, which require efficient electron transport systems for survival in diverse environments .

Research Findings and Genomic Context

While ubiA itself is not directly implicated in C. sakazakii pathogenicity, genomic studies highlight its role in bacterial physiology and adaptation:

  • Pan-Genome Analysis: C. sakazakii exhibits a large accessory genome, with frequent recombination events influencing metabolic and virulence gene diversity . Though ubiA is part of the core genome, its functional conservation underscores its importance in basic metabolic processes .

  • Antimicrobial Resistance (AMR): Though ubiA is not linked to AMR genes, C. sakazakii isolates often carry plasmid-encoded resistance determinants (e.g., fos, mdfA) and virulence factors (e.g., ompA, cpa) . These traits enable survival in hostile environments, potentially interacting with metabolic pathways involving ubiA.

  • Comparative Biochemistry: Orthologs of ubiA exist in other bacteria (e.g., Escherichia coli), but the C. sakazakii variant is distinguished by its octaprenyl specificity and pathogen-associated expression .

Applications in Scientific Research

The recombinant enzyme serves as a tool in:

  1. Ubiquinone Biosynthesis Studies: Elucidating prenyltransferase activity and substrate specificity in bacterial electron transport chains .

  2. Metabolic Engineering: Modulating UQ-8 production for bioenergy applications or antimicrobial drug development .

  3. Pathogen Physiology: Investigating how C. sakazakii balances metabolic and virulence-associated processes in infection models .

Challenges and Future Directions

  • Structural Insights: Limited crystallographic data exist for C. sakazakii ubiA. Future studies could resolve its 3D structure to inform inhibitor design.

  • Ecological Relevance: The enzyme’s role in C. sakazakii’s adaptation to food and host environments remains underexplored, necessitating transcriptomic/proteomic analyses .

  • Therapeutic Targeting: While ubiA is not currently a drug target, its conservation across pathogens suggests potential for broad-spectrum antimicrobials .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
ubiA; ESA_00086; 4-hydroxybenzoate octaprenyltransferase; 4-HB polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)
Target Names
ubiA
Target Protein Sequence
MEWSLTQNKLLAYHRLMRTDKPIGALLLLWPTLWALWVASPGVPPLWILAVFVAGVWLMR AAGCVVNDYADRKFDGHVKRTAHRPLPSGDVTEKEARNLFVILVLLSFLLVLTLNVKTIL LSVAALALAWMYPFMKRYTHLPQVVLGAAFGWSIPMAFCAVSESLPLSCWLMFFANICWA VAYDTEYAMVDRDDDVKIGVKSTAILFGRHDKLIIGLLQIAVLALLGTVGWLNGLGAFYY AGLAGAGALFIWQQKIIAGRDRDACFRAFLNNNYVGLLVFIGLALSYLKF
Uniprot No.

Target Background

Function
Catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. Mediates the second step in the final reaction sequence of ubiquinone-8 (UQ-8) biosynthesis, which is the condensation of the polyisoprenoid side chain with PHB, generating the first membrane-bound Q intermediate 3-octaprenyl-4-hydroxybenzoate.
Database Links
Protein Families
UbiA prenyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.