Recombinant Cronobacter sakazakii ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Cronobacter sakazakii ATP Synthase Subunit b (atpF)

Recombinant Cronobacter sakazakii ATP synthase subunit b (atpF) refers to the synthetically produced form of the ATP synthase subunit b protein from the bacterium Cronobacter sakazakii . C. sakazakii is an opportunistic foodborne pathogen known to cause severe infections, such as meningitis and necrotizing enterocolitis, particularly in neonates . ATP synthase, also known as F-ATPase, is a vital enzyme complex that produces adenosine triphosphate (ATP), the primary energy currency of cells .

Biological Significance of ATP Synthase Subunit b (atpF)

ATP synthase is crucial for energy production in bacteria, including C. sakazakii . The enzyme consists of two main components: the F0 sector, which is embedded in the membrane, and the F1 sector, which protrudes into the cytoplasm. Subunit b (atpF) is a key component of the F0 sector, essential for the structural integrity and function of the ATP synthase complex . Specifically, it functions in proton translocation across the membrane, which drives the rotation of the F0 sector and subsequent ATP synthesis by the F1 sector.

Characteristics of Recombinant Cronobacter sakazakii ATP Synthase Subunit b (atpF)

Recombinant ATP synthase subunit b (atpF) shares similar properties with its native counterpart but is produced using recombinant DNA technology. Key characteristics include:

  • Source: Typically produced in E. coli expression systems .

  • Purity: High purity levels can be achieved through purification methods .

  • Sequence Information: The protein sequence for C. sakazakii ATP synthase subunit b (atpF) is available in databases such as UniProt (A7MMX3) . The protein consists of 156 amino acids .

  • Expression Region: The expression region spans amino acids 1-156 of the protein .

  • Storage: Recommended storage conditions include storage at -20°C, with the addition of glycerol to a final concentration of 5-50% to maintain stability . Repeated freezing and thawing cycles should be avoided .

Gene and Protein Information

  • Gene Name: atpF

  • Ordered Locus Name: ESA_04010

  • Alternative Names: ATP synthase F(0) sector subunit b, ATP synthase subunit I, F-type ATPase subunit b, F-ATPase subunit b

  • Molecular Weight: The full-length recombinant protein has a predicted molecular weight of approximately 17 kDa.

Role in Virulence and Desiccation Tolerance

While ATP synthase subunit b (atpF) is primarily involved in energy production, some studies suggest links between ATP synthase and bacterial virulence or stress tolerance:

  • Desiccation Tolerance: C. sakazakii exhibits remarkable desiccation tolerance, enabling its persistence in low-water activity environments, such as powdered infant formula .

  • Biofilm Formation: Desiccation tolerance is related to the ability of C. sakazakii to form biofilms, enhancing its resistance to environmental stressors .

Applications of Recombinant Cronobacter sakazakii ATP Synthase Subunit b (atpF)

  1. ELISA Assays: Recombinant atpF can be used as an antigen in enzyme-linked immunosorbent assays (ELISA) for detecting anti-C. sakazakii antibodies or for quantifying atpF protein levels .

  2. Structural Studies: The recombinant protein can be used for X-ray crystallography or NMR spectroscopy to determine its three-dimensional structure, which can provide insights into its function and interactions within the ATP synthase complex.

  3. Drug Discovery: atpF may serve as a target for developing new antibacterial agents against C. sakazakii.

  4. Functional Studies: Recombinant atpF can be utilized in in vitro assays to study its role in ATP synthesis and proton translocation.

Relevant Tables

Table 1: Cronobacter species and characteristics

SpeciesClinical SignificanceSialic Acid UtilizationCapsule Profile
C. sakazakiiMeningitis, necrotizing enterocolitis (NEC)YesK2:CA2
C. malonaticusMeningitis, NECNoK2:CA2
C. turicensisVariableYes (some strains)K2:CA2, K1:CA2
C. dublinensisLess frequent clinical isolationNoNot applicable
C. muytjensiiLess frequent clinical isolationNoNot applicable

Table 2: Recombinant Cronobacter sakazakii ATP synthase subunit b (atpF) properties

PropertyDescription
SourceE. coli expression system
PurityHigh purity achieved through purification methods
Sequence Length156 amino acids
Storage BufferTris-based buffer with 50% glycerol
Storage Temperature-20°C (for extended storage, conserve at -20°C or -80°C)
Molecular Weight~17 kDa
Gene NameatpF
Locus NameESA_04010
Alternative NamesATP synthase F(0) sector subunit b, ATP synthase subunit I, F-type ATPase subunit b, F-ATPase subunit b

Research Findings

  1. Capsular Profiles and Clinical Significance: C. sakazakii strains associated with severe neonatal infections (meningitis and NEC) often exhibit a specific capsular profile (K2:CA2) .

  2. Sialic Acid Utilization: C. sakazakii possesses genes for sialic acid utilization, potentially aiding its adaptation to milk-based environments .

  3. Desiccation Tolerance Mechanisms: Disruption of glutathione transport-related genes can reduce desiccation tolerance in C. sakazakii .

  4. CRISPR-Cas Systems: C. dublinensis and C. muytjensii exhibit greater diversity in CRISPR-Cas profiles compared to C. sakazakii and C. malonaticus .

  5. Genome Analysis: Specific genes, such as DNA-methyltransferases and toxin-antitoxin pairs, have been identified in Cronobacter genomes, contributing to their survival and adaptation .

  6. Multilocus Sequence Typing (MLST): Genes like atpD (encoding ATP synthase B subunit) are used in MLST schemes for C. sakazakii to understand the genetic relatedness and evolution of different strains .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; ESA_04010; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)
Target Names
atpF
Target Protein Sequence
MNLNATILGQAIAFVLFVLFCMKYVWPPIMAAIEKRQKEIADGLSSAERAKKDLELAQSN ATDQLKKAKAEAQVIIEQANKRRAQILDEAKAEAEQERNKIVAQAQAEIEAERKRAREEL RKQVAILAVAGAEKIIERSVDEAANSDIVNKLVAEL
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core; and the F0 domain, containing the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits.

This protein is a component of the F0 channel, specifically part of the peripheral stalk, linking F1 to F0.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Cronobacter sakazakii ATP synthase subunit b and what is its role in bacterial metabolism?

ATP synthase subunit b (atpF) in Cronobacter sakazakii functions as a critical component of the F0 sector of ATP synthase, an essential enzyme complex that catalyzes ATP synthesis during oxidative phosphorylation. This protein consists of 156 amino acids and serves as a stator stalk that connects the F1 catalytic domain to the F0 membrane domain .

In bacterial metabolism, ATP synthase harnesses the energy of the proton motive force across the membrane to synthesize ATP from ADP and inorganic phosphate. Subunit b specifically contributes to the structural stability of the complex and anchors the catalytic portion to the membrane-embedded components, enabling the rotational mechanism necessary for ATP synthesis. This energy production is particularly crucial during various growth phases and environmental stress conditions that C. sakazakii encounters.

How is ATP synthase utilized in Cronobacter species classification?

ATP synthase genes play a significant role in Cronobacter species classification through multilocus sequence typing (MLST). While atpF itself is not directly used in the established MLST scheme, the related atpD gene (encoding ATP synthase β chain) is one of seven loci used for identification and discrimination of Cronobacter species .

The atpD gene fragment (390 bp) used in MLST analysis shows approximately 10.8% polymorphic sites and 12 different alleles across analyzed strains . The low ratio of non-synonymous to synonymous substitutions (dN/dS = 0.006) indicates strong purifying selection, confirming its suitability as a phylogenetic marker . This classification system has proven more robust than traditional biotyping schemes for identifying and discriminating between C. sakazakii and C. malonaticus strains.

How does ATP synthase expression in Cronobacter sakazakii respond to environmental stressors?

Transcriptomic analyses reveal that C. sakazakii undergoes extensive gene expression changes in response to environmental conditions. When C. sakazakii BAA-894 was grown in minimal medium (M9) compared to rich medium (LB), a total of 3,956 genes were differentially expressed, with 2,339 up-regulated and 1,617 down-regulated .

While the specific regulation of ATP synthase genes was not detailed in the studies, the global impact of amino acid deficiency suggests significant metabolic adaptation. Energy production pathways, including ATP synthase components, likely undergo regulation to optimize energy utilization under stress conditions. This adaptation mechanism is particularly relevant for understanding how C. sakazakii survives in various environments, including food processing facilities and during host infection.

What methodological approaches are most effective for studying ATP synthase function in Cronobacter sakazakii?

Several methodological approaches can be employed to study ATP synthase function in C. sakazakii:

Table 1: Methodological Approaches for ATP Synthase Research

ApproachTechniquesApplications
GeneticGene knockout; Site-directed mutagenesis; Reporter gene fusionsPhenotypic assessment; Structure-function analysis; Expression monitoring
BiochemicalProtein purification; Activity assays; Proton translocation measurementsFunctional characterization; Kinetic analysis; Transport studies
StructuralCryo-electron microscopy; Cross-linking studies; Molecular dynamicsComplex structure determination; Interaction mapping; Conformational analysis
Systems biologyTranscriptomics; Metabolomics; Flux analysisExpression profiling; Metabolic impact assessment; Energy production quantification

Transcriptomic analysis has been successfully employed to study gene expression in C. sakazakii under different growth conditions , and this approach could be applied specifically to ATP synthase components to understand their regulation under various environmental conditions.

What is the relationship between ATP synthase and biofilm formation in Cronobacter sakazakii?

The relationship between ATP synthase and biofilm formation in C. sakazakii involves complex metabolic interconnections. While ATP synthase is not directly identified as a biofilm-related gene in current research, energy production genes such as cytochrome o ubiquinol oxidase protein CyoD have been implicated in biofilm formation .

ATP synthase likely plays a supportive role by providing the energy required for biofilm development and maintenance. Research has shown that when specific biofilm-related genes in C. sakazakii are mutated, biofilm formation is affected, with quantifiable changes in production . The energy demands during different stages of biofilm development (attachment, maturation, dispersal) may require regulated ATP synthase activity to support these processes.

What are the optimal storage and handling conditions for recombinant Cronobacter sakazakii ATP synthase subunit b?

For optimal preservation of recombinant C. sakazakii ATP synthase subunit b activity and integrity, researchers should follow these evidence-based storage and handling protocols:

  • Store the protein at -20°C for regular use, or at -80°C for extended storage periods

  • Use the supplied Tris-based buffer containing 50% glycerol, which is optimized for this specific protein

  • Avoid repeated freeze-thaw cycles, as they can compromise protein structure and activity

  • For ongoing experiments, maintain working aliquots at 4°C for up to one week

  • Before experimental use, validate protein integrity using techniques such as SDS-PAGE, Western blotting, or activity assays

These conditions are designed to maintain structural integrity and functional activity. Researchers should validate stability in their specific experimental conditions, particularly if using specialized assay buffers or additives.

How can researchers verify the activity and integrity of recombinant ATP synthase preparations?

Verifying the activity and integrity of recombinant ATP synthase subunit b preparations requires multiple complementary approaches:

Protein integrity verification:

  • SDS-PAGE to confirm molecular weight (expected ~16 kDa) and purity

  • Western blotting with specific antibodies

  • Mass spectrometry to verify sequence and identify any post-translational modifications

  • Circular dichroism to assess secondary structure composition

Functional assays:

  • ATP synthase reconstitution if studying the whole complex

  • Binding assays to verify interactions with other ATP synthase subunits

  • In vitro assembly studies to confirm proper complex formation

Structural integrity assessment:

  • Thermal shift assays to determine protein stability

  • Size exclusion chromatography to verify oligomerization state

  • Limited proteolysis to probe for proper folding

These verification methods ensure that experimental results accurately reflect the protein's natural properties and functions within the ATP synthase complex.

What experimental controls should be included when studying Cronobacter sakazakii ATP synthase?

When designing experiments involving C. sakazakii ATP synthase, researchers should incorporate the following controls:

Table 2: Recommended Experimental Controls

Control TypeExamplePurpose
Positive controlE. coli ATP synthase subunit bVerify assay function with well-characterized homolog
Negative controlDenatured protein preparationEstablish baseline for non-specific effects
Expression controlWestern blot of whole-cell lysatesConfirm expression levels under various conditions
Genetic controlatpF deletion mutantValidate phenotypes attributed to atpF disruption
Technical controlsBuffer-only samples; non-specific proteinsControl for buffer effects and non-specific interactions
Biological replicatesMultiple independent cultures/preparationsEnsure reproducibility and statistical validity

These controls help distinguish specific effects related to ATP synthase function from experimental artifacts or non-specific effects, increasing the reliability and reproducibility of research findings.

How can ATP synthase genes be used for molecular typing and epidemiological studies of Cronobacter species?

ATP synthase genes, particularly atpD, have proven valuable for molecular typing and epidemiological studies of Cronobacter species. The established multilocus sequence typing (MLST) scheme incorporates atpD (ATP synthase β chain) as one of seven loci for strain discrimination .

Analysis of 60 C. sakazakii and 16 C. malonaticus strains identified 12 sequence types (STs) in C. sakazakii and 3 in C. malonaticus . Notably, ST4 contained 22/60 C. sakazakii strains with nearly equal numbers of clinical and infant formula isolates spanning from 1951 to 2008, while ST8 appeared particularly virulent with 7/8 strains being clinical isolates from four countries between 1977-2006 .

This MLST approach provides several advantages for epidemiological research:

  • Higher discriminatory power than traditional biotyping

  • Ability to track specific lineages across time and geography

  • Identification of potentially hypervirulent sequence types

  • A standardized framework for global surveillance

The established Cronobacter MLST database (http://pubmlst.org/cronobacter/) serves as a valuable resource for researchers conducting epidemiological investigations and outbreak analyses .

What role does ATP synthase play in the virulence and pathogenicity of Cronobacter sakazakii?

While ATP synthase primarily functions in energy metabolism rather than as a direct virulence factor, it plays a supportive role in pathogenicity by powering various virulence-associated processes. C. sakazakii has been associated with severe infant infections, particularly meningitis, and can cross the blood-brain barrier to affect the central nervous system .

ATP synthase likely supports these virulence mechanisms by providing energy for:

  • Adhesion to and invasion of host cells

  • Production and secretion of toxins and other virulence factors

  • Resistance to host defense mechanisms

  • Adaptation to the nutrient-limited environment within the host

This supportive role makes ATP synthase an indirect contributor to pathogenicity. Research has identified that C. sakazakii produces bioactive compounds that can modify host immune regulatory genes, affecting the expression of genes involved in pathogen recognition and kinase activity such as clec-60, clec-87, lys-7, akt-2, pkc-1, and jnk-1 . The energy requirements for producing these compounds likely depend on functional ATP synthase.

How does ATP synthase contribute to Cronobacter sakazakii survival under nutrient limitation?

Transcriptomic analyses reveal that C. sakazakii undergoes substantial gene expression changes in response to nutrient limitation. When grown in minimal medium (M9) compared to rich medium (LB), C. sakazakii BAA-894 showed differential expression of 3,956 genes . Under amino acid deficiency, genes relevant to exopolysaccharide biosynthesis were significantly up-regulated, while genes involved in flagellum formation and chemotaxis were down-regulated .

Although specific data on ATP synthase regulation is not detailed in the current research, the global metabolic reconfiguration suggests that energy production pathways are likely optimized to support survival under nutrient stress. This adaptation mechanism is crucial for C. sakazakii's persistence in environments with limited nutrients, such as during food processing, storage, or within certain host tissues.

The production of exopolysaccharides under nutrient limitation is particularly noteworthy, as this process requires significant energy input, suggesting a prioritization of ATP utilization toward protective mechanisms rather than motility under stress conditions.

What are promising research areas involving Cronobacter sakazakii ATP synthase as a potential antimicrobial target?

ATP synthase represents a promising antimicrobial target due to its essential role in bacterial energy metabolism. Several research directions could be explored:

  • Structure-based drug design: Determining the unique structural features of C. sakazakii ATP synthase could facilitate the development of specific inhibitors that target this pathogen while minimizing effects on human ATP synthase.

  • Natural products screening: Identifying natural compounds that specifically inhibit bacterial ATP synthase could provide lead molecules for antimicrobial development.

  • Combination therapy approaches: Investigating synergistic effects between ATP synthase inhibitors and existing antibiotics could enhance antimicrobial efficacy.

  • Membrane permeabilization strategies: Developing compounds that specifically increase proton permeability in C. sakazakii could uncouple ATP synthesis and deplete energy reserves.

  • Nanoparticle delivery systems: Engineering nanoparticles to deliver ATP synthase inhibitors specifically to C. sakazakii could increase therapeutic efficacy while reducing off-target effects.

This research holds particular promise given the increasing concerns about antimicrobial resistance and the need for new therapeutic approaches against opportunistic pathogens like C. sakazakii.

How might comparative analyses of ATP synthase across Cronobacter species contribute to evolutionary studies?

Comparative analyses of ATP synthase across Cronobacter species could provide valuable insights into evolutionary relationships and adaptation mechanisms:

  • Phylogenetic analysis: Constructing phylogenetic trees based on ATP synthase gene sequences could clarify evolutionary relationships within the Cronobacter genus and between Cronobacter and related genera.

  • Selection pressure analysis: Examining the ratio of non-synonymous to synonymous substitutions in ATP synthase genes across species could identify regions under different selective pressures.

  • Adaptive evolution: Investigating ATP synthase variations in Cronobacter species from different ecological niches could reveal adaptations to specific environmental conditions.

  • Horizontal gene transfer: Analyzing ATP synthase gene sequences could identify potential instances of horizontal gene transfer and its role in Cronobacter evolution.

  • Ancestral sequence reconstruction: Reconstructing ancestral ATP synthase sequences could provide insights into the evolutionary trajectory of energy metabolism in these bacteria.

These studies would complement existing MLST-based approaches and contribute to our broader understanding of bacterial evolution and adaptation mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.