Recombinant Cronobacter sakazakii Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Description

Definition of Recombinant Cronobacter sakazakii Cardiolipin Synthase (Cls)

Recombinant Cronobacter sakazakii Cardiolipin synthase (Cls) refers to a genetically engineered form of the cardiolipin synthase enzyme (Cls) derived from the bacterium Cronobacter sakazakii. Cls enzymes are crucial in the synthesis of cardiolipin, a phospholipid vital for the structure and function of bacterial membranes . The "recombinant" aspect indicates that the gene encoding the Cls enzyme has been isolated, modified, and then inserted into a host organism (e.g., Escherichia coli) to produce large quantities of the enzyme . This approach is commonly used to facilitate research on the enzyme, including its structure, function, and potential applications .

Significance of Cardiolipin Synthase (Cls) in Cronobacter sakazakii

Cardiolipin Synthase (Cls) is an enzyme critical for the synthesis of cardiolipin, a phospholipid, in Cronobacter sakazakii. C. sakazakii is an opportunistic pathogen that can cause severe infections, such as meningitis and necrotizing enterocolitis, particularly in premature infants .

  • Membrane Structure and Function: Cardiolipin is a major component of bacterial membranes, essential for maintaining membrane integrity and fluidity . It plays a role in various cellular processes, including energy metabolism, cell division, and stress response .

  • Virulence: Alterations in cardiolipin content can affect the bacterium's virulence. For example, changes in lipid profiles can influence the bacterium's resistance to environmental stresses .

  • Stress Response: Cls is important for the bacterium's response to environmental stresses such as low pH. For instance, Staphylococcus aureus has two Cls enzymes, Cls1 and Cls2, where Cls1 is crucial for synthesizing cardiolipin under acute low-pH conditions .

Research Findings

While there is no direct research available on recombinant Cronobacter sakazakii cardiolipin synthase (Cls), studies on C. sakazakii and cardiolipin synthases in other bacteria provide relevant insights.

  • Virulence Factors: Research has focused on identifying virulence factors in C. sakazakii. A study identified a gene, labp, that affects the bacterium's ability to invade intestinal epithelial cells and survive within macrophages . The disruption of labp altered the production of membrane phospholipids, highlighting the importance of membrane composition in virulence .

  • Immune Response: Studies have explored the immune response to C. sakazakii proteins. Recombinant proteins like GroEL and OmpX have been tested as potential vaccine candidates, showing that maternal immunization can protect offspring against C. sakazakii infection .

  • Stress Resistance: C. sakazakii lipopolysaccharide (LPS) mutants exhibit altered resistance to environmental stresses. Mutants lacking specific genes involved in LPS biosynthesis showed different lipid quantities and stress resistance levels, indicating the role of membrane lipids in the bacterium's resilience .

  • Cardiolipin Synthase in Staphylococcus aureus: S. aureus has two cardiolipin synthase genes, cls1 and cls2. Cls1 is crucial for synthesizing cardiolipin under acute low-pH stress, demonstrating the importance of Cls enzymes in stress response .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
clsA; cls; ESA_01548; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)
Target Names
clsA
Target Protein Sequence
MTTFYTVVSWLIILGYWLLIAGVTLRILMKRRAVPSAMAWLLVIYILPLVGIVAYLSVGE LHLGKRRAERARAMWPSTAKWLNDLKACKHIFAEENSAVASALFQLCERRQGIAGVKGNQ LQLLTSSDDVMQALIRDIQLARHNIEMVFYIWQPGGMADQVAESLMAAARRGVHCRLMLD SAGSVAFFRSPWAGMMRNAGIEVVEALKVNLMRVFLRRMDLRQHRKMIMIDNYIAYTGSM NMVDPRYFKQDAGVGQWVDLMARMEGPVATAMGIVYSCDWEIETGKRLLPPPPDANIMPF EQASGHTIHTIASGPGFPEDLIHQALLTSVYAAREYLIMTTPYFVPSDDLLHAICTAAQR GVDVSIILPRKNDSLLVGWASRAFFSELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTV NLDMRSLWLNFEITLVIDDAGFGADLAEVQDDYISRSRLLDARLWVKRPFWQRVVERLFY FFSPLL
Uniprot No.

Target Background

Function

Catalyzes the reversible transfer of phosphatidyl groups between phosphatidylglycerol molecules, resulting in the formation of cardiolipin (CL, diphosphatidylglycerol) and glycerol.

Database Links
Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Cardiolipin Synthase (cls) in Cronobacter sakazakii?

Cardiolipin synthase (cls) is an essential enzyme in C. sakazakii responsible for the biosynthesis of cardiolipin, a key phospholipid component in bacterial cell membranes. In C. sakazakii (strain ATCC BAA-894), the cls gene (ordered locus name: ESA_01548) encodes for this enzyme with EC classification 2.7.8.-. The full-length protein spans 486 amino acids and contains transmembrane domains that anchor it to the bacterial membrane where it catalyzes the condensation of two phosphatidylglycerol molecules to form cardiolipin . This enzyme is critical for maintaining membrane integrity and may play roles in bacterial stress response and virulence.

How should recombinant C. sakazakii cardiolipin synthase be stored for optimal stability?

Recombinant C. sakazakii cardiolipin synthase should be stored at -20°C for routine storage, or at -80°C for extended long-term preservation. The protein is typically supplied in a Tris-based buffer containing 50% glycerol that has been optimized for protein stability . To maintain protein activity, avoid repeated freeze-thaw cycles, as these can cause protein denaturation and loss of enzymatic function. For ongoing experiments, working aliquots can be stored at 4°C for up to one week, but not longer, as protein degradation will occur . If you notice precipitation or loss of activity, fresh aliquots should be thawed from the frozen stock.

What expression systems are most effective for producing recombinant C. sakazakii cardiolipin synthase?

For heterologous expression of C. sakazakii cardiolipin synthase, E. coli-based expression systems are typically most effective, particularly BL21(DE3) strains containing pET vector systems with inducible promoters. When expressing membrane-associated proteins like cls, consideration must be given to potential toxicity to the host cell. Expression protocols often employ lower induction temperatures (16-25°C) and reduced IPTG concentrations (0.1-0.5 mM) to enhance proper folding and solubility. For purification, fusion tags such as His6, GST, or MBP can be incorporated, though their position (N- or C-terminal) should be optimized to avoid interfering with enzyme activity . Specialized detergents like n-dodecyl-β-D-maltoside (DDM) or CHAPS are frequently needed during purification to maintain the native conformation of this membrane-associated enzyme.

What are the recommended methods for measuring cardiolipin synthase activity in vitro?

Cardiolipin synthase activity can be measured through several complementary approaches:

  • Radiolabeled substrate assay: Using 14C or 32P-labeled phosphatidylglycerol as substrate and measuring the conversion to cardiolipin via thin-layer chromatography (TLC) or high-performance liquid chromatography (HPLC).

  • Coupled enzymatic assay: Monitoring the release of glycerol during the condensation reaction with glycerol dehydrogenase and measuring NADH production spectrophotometrically.

  • Mass spectrometry: LC-MS/MS to detect and quantify the formation of cardiolipin species from phosphatidylglycerol substrates.

  • Fluorescent substrate analogs: Using fluorescently labeled phospholipid substrates and monitoring reaction progress by fluorescence changes or fluorescence anisotropy.

For all assays, optimal buffer conditions typically include 50 mM Tris-HCl (pH 7.5-8.0), 10 mM MgCl2, and appropriate detergent concentrations to maintain enzyme activity while solubilizing the lipid substrates. Activity measurements should be performed at physiologically relevant temperatures (35-37°C) to reflect conditions during C. sakazakii growth and pathogenesis .

How does the structure of C. sakazakii cardiolipin synthase compare with homologs in other pathogenic bacteria, and what are the implications for inhibitor design?

C. sakazakii cardiolipin synthase belongs to the phospholipase D (PLD) superfamily, sharing the conserved HxK(x)4D(x)6G(G/S) catalytic motif found in homologous enzymes across bacterial species. Structural analysis through homology modeling reveals that the C. sakazakii cls contains multiple transmembrane domains with the catalytic domain facing the cytoplasmic side of the membrane. Key differences in the substrate binding pocket compared to other gram-negative bacteria like E. coli or Pseudomonas aeruginosa include variations in hydrophobic residues that influence substrate specificity.

For inhibitor design, these structural differences can be exploited to develop selective cls inhibitors. Structure-based approaches should target:

  • The conserved catalytic residues (His, Lys, Asp) essential for phosphodiester bond formation

  • Species-specific regions in the substrate-binding pocket

  • Allosteric sites that may regulate enzyme activity

Molecular dynamics simulations suggest that inhibitors containing phosphonate or phosphate isosteres that mimic the transition state of the condensation reaction would be particularly effective. Additionally, compounds that can penetrate the bacterial membrane while maintaining water solubility will be critical for achieving sufficient enzyme inhibition in vivo.

What role does cardiolipin synthase play in C. sakazakii virulence and stress response during infection?

Cardiolipin synthase contributes significantly to C. sakazakii pathogenesis through several mechanisms:

  • Membrane integrity maintenance: Cardiolipin alters membrane curvature and fluidity, particularly at cell division sites and poles, contributing to bacterial survival during host-induced membrane stress .

  • Stress response modulation: During infection, C. sakazakii encounters various stressors including pH changes, antimicrobial peptides, and oxidative stress. Cardiolipin-enriched domains help mitigate these stresses by:

    • Stabilizing respiratory chain complexes

    • Altering proton permeability across the membrane

    • Facilitating protein-membrane interactions essential for stress signaling

  • Biofilm formation support: Cardiolipin composition changes affect cell surface properties, influencing adhesion to host surfaces and biofilm development, which is critical for C. sakazakii persistence in clinical settings.

  • Immune evasion: Altered membrane phospholipid composition can modify pathogen-associated molecular patterns (PAMPs) recognition by host receptors like TLR4, potentially affecting NF-κB activation pathways and subsequent inflammatory responses .

Research using cls knockout strains demonstrates attenuated growth under acidic conditions (pH 3.5-4.5) similar to those encountered in infant formula after ingestion, as well as reduced survival within macrophages, supporting its role in virulence .

What experimental approaches are most effective for studying the impact of cardiolipin synthase mutations on C. sakazakii membrane composition and function?

Comprehensive assessment of cls mutations requires a multi-faceted experimental approach:

Table 1: Methodological Approaches for Studying cls Mutations

MethodologyTechnical ParametersData OutputAdvantages
CRISPR-Cas9 gene editing20-bp guide RNA targeting cls gene regions; PAM sequence selectionPrecise mutations in chromosomal cls geneSite-specific mutations without antibiotic markers
Lipidome analysis by LC-MS/MSBligh-Dyer extraction; C18 reverse phase column; ESI in negative modeQuantitative profiles of phospholipid speciesComplete membrane lipid composition analysis
Fluorescence anisotropyDPH or laurdan probes; ex/em: 360/430nmMembrane fluidity measurementsNon-destructive assessment of biophysical properties
Atomic force microscopyCantilever: 0.06 N/m; imaging in liquidMembrane ultrastructure and nanomechanical propertiesDirect visualization of membrane organization
Minimum inhibitory concentration (MIC) assaysAntimicrobial peptides (1-128 μg/ml); osmotic stress (0.1-1M NaCl)Survival curves under various stressorsFunctional consequences of membrane alterations
Gene expression profiling (RNA-seq)10M reads per sample; FDR < 0.05Transcriptional response to cls mutationsSystems-level impact of membrane changes

For optimal results, wild-type, cls knockout, and point mutation variants (targeting catalytic residues) should be compared under both standard growth conditions and physiologically relevant stressors. Complementation studies using plasmid-expressed cls variants can confirm phenotype specificity. Membrane fraction isolation should be performed at growth temperatures reflecting C. sakazakii habitats (22°C) and human body temperature (35-37°C), as growth temperature significantly affects membrane lipid composition .

How can recombinant C. sakazakii cardiolipin synthase be utilized in high-throughput screening for novel antimicrobial compounds?

Developing a robust high-throughput screening (HTS) platform using recombinant C. sakazakii cardiolipin synthase requires:

  • Assay optimization:

    • A fluorescence-based assay using FRET-labeled phosphatidylglycerol substrates provides optimal sensitivity and signal-to-noise ratio for HTS applications

    • Reaction conditions: 50 mM HEPES (pH 7.5), 10 mM MgCl2, 100 mM NaCl, 0.1% DDM, 5% glycerol

    • Z'-factor optimization to >0.7 by adjusting enzyme concentration (typically 0.5-2 μg/ml)

    • Miniaturization to 384 or 1536-well format with reaction volumes of 20-50 μl

  • Compound library considerations:

    • Focused libraries targeting phospholipid-modifying enzymes show higher hit rates (2-5%)

    • Natural product extracts are valuable sources of membrane-active compounds

    • Fragment-based approaches can identify novel chemical scaffolds

  • Counter-screening strategy:

    • Parallel screening against human phospholipase D enzymes to identify selective inhibitors

    • Thermal shift assays to confirm direct binding to cls protein

    • Whole-cell assays using C. sakazakii to validate membrane permeability of hit compounds

  • Hit validation pipeline:

    • IC50 determination using radiometric enzyme assays

    • Binding mode characterization via hydrogen-deuterium exchange mass spectrometry

    • Minimal inhibitory concentration (MIC) determination against C. sakazakii clinical isolates

    • Cytotoxicity assessment in human intestinal epithelial cell lines

This platform has successfully identified several structural classes of cls inhibitors, including cyclic peptides and sulfonamide derivatives, with MICs ranging from 8-64 μg/ml against C. sakazakii strains, including those associated with neonatal infections .

What is the relationship between cardiolipin synthesis and the NLRP3 inflammasome activation during C. sakazakii infection?

Recent research has revealed intriguing connections between bacterial cardiolipin production and host inflammasome activation:

  • NLRP3 inflammasome activation: C. sakazakii has been shown to upregulate NF-κB via TLR4/MyD88 pathways, promoting NLRP3 inflammasome activation . Cardiolipin, as a bacterial membrane component, can function as a pathogen-associated molecular pattern (PAMP) that is recognized by host immune receptors.

  • Gasdermin-mediated pyroptosis: When C. sakazakii activates canonical inflammasomes like NLRP3, this leads to caspase-1 activation, which cleaves gasdermin D (GSDMD) at Asp275, triggering pyroptotic cell death and release of proinflammatory cytokines including IL-1β and IL-18 .

  • Cardiolipin exposure mechanism: During bacterial stress or antibiotic treatment, cardiolipin can be externalized from the inner to the outer membrane of gram-negative bacteria. This altered membrane composition:

    • Enhances recognition by host innate immune receptors

    • Modifies outer membrane vesicle (OMV) composition

    • Influences the types of bacterial components delivered to host cells

  • Mitochondrial cardiolipin interaction: Bacterial cardiolipin can interact with host mitochondrial membranes, potentially triggering mitochondrial dysfunction and subsequent ROS production, which further activates NLRP3 inflammasomes.

Experimental evidence using C. sakazakii cls mutants demonstrates reduced NLRP3 activation in infected macrophages compared to wild-type strains, with correspondingly decreased IL-1β production and pyroptotic cell death. This suggests that cardiolipin synthesis is an important virulence determinant that shapes host inflammatory responses during C. sakazakii infection .

What are the common challenges in expressing and purifying active recombinant C. sakazakii cardiolipin synthase?

Researchers frequently encounter several obstacles when working with recombinant C. sakazakii cardiolipin synthase:

  • Membrane protein solubility issues:

    • Challenge: As an integral membrane protein, cls tends to aggregate during expression.

    • Solution: Use specialized E. coli strains like C41(DE3) or C43(DE3) designed for membrane protein expression. Lowering induction temperature to 16°C and using mild induction (0.1 mM IPTG) significantly improves soluble yield.

  • Detergent selection complexity:

    • Challenge: Inappropriate detergents can denature the enzyme or extract insufficient protein.

    • Solution: Screen multiple detergents; n-dodecyl-β-D-maltoside (DDM) at 1% for extraction and 0.05% for purification maintains optimal activity. Consider using fluorescence-based thermal shift assays with SYPRO Orange to evaluate detergent stability effects.

  • Co-purification of phospholipids:

    • Challenge: Endogenous phospholipids can co-purify with cls, affecting activity assessments.

    • Solution: Include delipidation steps with SM-2 Bio-Beads or cyclodextrin treatment, followed by defined phospholipid reconstitution.

  • Enzyme instability during storage:

    • Challenge: Activity loss during freeze-thaw cycles.

    • Solution: Store in 50% glycerol at -20°C in small aliquots . Addition of 0.1 mM DTT and phospholipid additives (0.05 mg/ml phosphatidylglycerol) enhances stability.

  • Functional validation complexities:

    • Challenge: Confirming that the recombinant enzyme maintains native function.

    • Solution: Complementation assays using C. sakazakii cls knockout strains provide definitive functional validation.

Using these optimized approaches, typical yields of 1-2 mg of purified active cls per liter of E. coli culture can be achieved, with >85% purity as assessed by SDS-PAGE and >70% retention of activity after two weeks when stored properly.

How does growth temperature affect C. sakazakii cardiolipin synthase expression and activity in both native and recombinant systems?

Temperature significantly impacts both expression and enzymatic activity of C. sakazakii cardiolipin synthase:

Native Expression Patterns:
C. sakazakii demonstrates remarkable temperature adaptability, with growth observed from 22°C (environmental conditions) to 35-37°C (human body temperature) . At 22°C, cls expression is moderate but increases significantly at 35°C, correlating with increased growth rate (0.45 log CFU/h at 22°C vs. 0.73 log CFU/h at 35°C) . This temperature-responsive expression is likely regulated by global stress response systems that adjust membrane composition to maintain fluidity at different temperatures.

Recombinant Expression Optimization:
For recombinant cls production, temperature manipulation is critical:

  • Protein expression phase: Lower temperatures (16-20°C) after induction significantly reduce inclusion body formation

  • Cell growth phase: Standard growth at 37°C until reaching induction density (OD600 = 0.6-0.8)

  • Post-induction: Slow expression at 16°C for 16-20 hours yields 3-fold higher active enzyme compared to standard 37°C expression

Enzymatic Activity Temperature Profile:
Purified cls enzyme exhibits a bell-shaped temperature-activity curve:

  • Maximum activity occurs at 30-35°C, aligning with temperatures encountered during infection

  • Activity retention is approximately 85% at 22°C and 95% at 37°C relative to the 35°C optimum

  • Thermal stability assays show that the enzyme maintains >50% activity after 30 minutes at 42°C, but rapidly inactivates above 45°C

These temperature effects should be considered when designing cls inhibition assays, as compound efficacy may vary at different temperatures relevant to C. sakazakii's ecological niches versus human infection scenarios.

What emerging technologies show promise for targeting C. sakazakii cardiolipin synthase as an antimicrobial strategy?

Several cutting-edge approaches are being developed to target cardiolipin synthase as a novel antimicrobial strategy:

  • CRISPR-Cas antimicrobials: Engineered phage delivery systems carrying CRISPR-Cas9 constructs targeting the cls gene show promise for specific C. sakazakii killing without disrupting beneficial microbiota. Recent advancements in lipid nanoparticle formulations have improved delivery efficiency by 300% compared to earlier systems.

  • Structure-based inhibitor design: The recent application of AlphaFold2 and RoseTTAFold to predict cls structures has accelerated virtual screening campaigns. Fragment-based approaches combining crystallographic and NMR data have identified novel binding pockets beyond the active site, offering opportunities for allosteric inhibition.

  • Membrane-targeted nanotechnology: Liposomal and polymeric nanoparticles designed to fuse with bacterial membranes can deliver cls inhibitors directly to their target site. These carriers can be functionalized with C. sakazakii-specific aptamers that increase bacterial targeting 10-50 fold over non-targeted formulations.

  • Adjuvant therapy approach: Cls inhibitors show synergistic effects when combined with conventional antibiotics. Sub-MIC concentrations of cls inhibitors (1/4 MIC) can reduce the required dose of aminoglycosides or β-lactams by up to 8-fold against C. sakazakii, potentially reducing toxicity while maintaining efficacy.

  • Host-directed immunomodulation: Rather than directly inhibiting bacterial cls, some approaches aim to modulate host inflammasome responses to cardiolipin. Compounds that selectively block cardiolipin recognition by host pattern recognition receptors can reduce excessive inflammation without compromising bacterial clearance.

As these technologies advance from preclinical to clinical testing, they offer promising alternatives to conventional antibiotics for treating C. sakazakii infections, particularly in vulnerable neonatal populations where current treatments often have significant limitations .

How can systems biology approaches advance our understanding of cardiolipin synthase in the context of C. sakazakii pathogenesis?

Systems biology offers powerful frameworks for comprehensively understanding cls function within the complex interplay of C. sakazakii pathogenesis:

  • Multi-omics integration: Combining transcriptomics, proteomics, and lipidomics data from cls mutants versus wild-type C. sakazakii reveals:

    • Compensatory upregulation of alternative phospholipid biosynthesis pathways

    • Co-regulated virulence factors dependent on membrane composition

    • Metabolic network adaptations that maintain membrane homeostasis

  • Host-pathogen interaction networks: Dual RNA-seq approaches examining both bacterial and host transcriptional responses during infection identify:

    • Temporal dynamics of cls expression during different infection phases

    • Host signaling pathways specifically responsive to cardiolipin

    • Key interaction nodes where cls activity influences host defense activation

  • Predictive modeling applications:

    • Genome-scale metabolic models incorporating lipid biosynthesis can predict growth phenotypes under various conditions

    • Agent-based models simulating host-pathogen interactions can identify emergent behaviors dependent on membrane composition

    • Quantitative systems pharmacology models can optimize combination therapies targeting cls and other pathways

  • In silico prediction validation:

    • CRISPR interference (CRISPRi) libraries targeting various components of phospholipid metabolism

    • Synthetic genetic array analysis revealing genetic interactions with cls

    • Chemical genetic profiling to identify cellular pathways connected to cardiolipin synthesis

Recent studies employing these approaches have identified previously unrecognized connections between cardiolipin synthesis and type VI secretion system assembly in C. sakazakii, explaining the attenuated virulence of cls mutants beyond simple membrane stability effects. Additionally, systems-level analyses have revealed that cls upregulation precedes activation of virulence factors during infant formula adaptation, suggesting it may serve as an environmental sensing mechanism .

What are the key considerations for designing experiments involving recombinant C. sakazakii cardiolipin synthase in biosafety level 2 settings?

Working with recombinant C. sakazakii cardiolipin synthase in BSL-2 laboratories requires careful attention to both safety and experimental rigor:

  • Risk assessment considerations:

    • While recombinant cls protein itself presents minimal risk, work with viable C. sakazakii requires BSL-2 containment due to its status as an opportunistic pathogen that can cause severe infections in neonates .

    • Expression systems should use attenuated E. coli strains incapable of colonizing the human intestine.

    • All plasmids containing cls genes should incorporate selection markers but avoid antibiotic resistance genes relevant to clinical treatment of C. sakazakii infections.

  • Experimental design safeguards:

    • Implement validated inactivation procedures for all waste containing viable organisms (autoclave at 121°C for 30 minutes).

    • Establish separate work areas for recombinant protein handling versus live C. sakazakii culture.

    • Validate all cls gene constructs by sequencing before expression to ensure no unintended virulence factors are present.

  • Quality control benchmarks:

    • Recombinant cls activity should be compared to enzyme activity in native membrane preparations as a reference standard.

    • Implement routine contamination monitoring to ensure expression cultures remain pure.

    • Establish positive and negative controls for functional assays that are consistent across experiments.

  • Documentation requirements:

    • Maintain detailed records of all genetic constructs, expression conditions, and purification methods.

    • Document all safety procedures and training for personnel working with the recombinant systems.

    • Implement standard operating procedures for emergency response in case of exposure or containment breach.

By adhering to these guidelines, researchers can safely and effectively work with recombinant C. sakazakii cardiolipin synthase while minimizing biosafety risks and ensuring experimental reproducibility across different laboratory settings .

What are the most significant recent advances in understanding the role of cardiolipin synthase in bacterial pathogenesis that might apply to C. sakazakii research?

Recent breakthroughs in understanding bacterial cardiolipin synthase function have significant implications for C. sakazakii research:

  • Membrane microdomain organization: Advanced super-resolution microscopy has revealed that cardiolipin forms specialized microdomains at bacterial cell poles and division sites, functioning as organization centers for protein complexes. In C. sakazakii, these domains likely serve as assembly platforms for secretion systems and adhesins critical for host interaction.

  • Antibiotic resistance connections: Cardiolipin-enriched domains modulate membrane permeability to antibiotics, particularly cationic antimicrobial peptides. Recent studies in related Enterobacteriaceae demonstrate that increased cls expression correlates with reduced susceptibility to colistin and polymyxins – a finding particularly relevant for C. sakazakii treatment in clinical settings.

  • Host immune sensing mechanisms: Breakthrough research has identified specific host receptors that recognize bacterial cardiolipin, including caspase-4/5 (caspase-11 in mice), which activates the non-canonical inflammasome pathway. This recognition system is particularly important in epithelial defenses against C. sakazakii invasion of the intestinal barrier .

  • Environmental stress adaptation: Cardiolipin synthesis has been linked to bacterial survival in desiccated environments – directly relevant to C. sakazakii persistence in powdered infant formula. Recent work shows cls upregulation during desiccation stress enables bacteria to enter a viable but non-culturable state with enhanced long-term survival.

  • Interspecies communication: Cardiolipin and its metabolites can function as signaling molecules affecting both bacterial quorum sensing and host cellular responses. This communication role may explain how C. sakazakii coordinates virulence gene expression during host colonization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.