Recombinant Cronobacter sakazakii Electron transport complex protein RnfE (rnfE)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant RnfE

Recombinant Cronobacter sakazakii Electron Transport Complex Protein RnfE (rnfE) is a genetically engineered protein derived from the bacterium Cronobacter sakazakii. This protein is a component of the electron transport complex, critical for energy production via the electron transport chain. The recombinant form is produced through heterologous expression systems, enabling controlled synthesis and purification for research applications.

Research Applications

  1. Immunoassay Development:

    • Used as an antigen in ELISA or WB to study antibody responses in C. sakazakii infections.

    • Potential utility in diagnosing infections or monitoring vaccine efficacy.

  2. Functional Studies:

    • Investigating electron transport dynamics in C. sakazakii under stress conditions (e.g., desiccation, oxidative stress).

    • Exploring interactions with other electron transport complex components (e.g., RnfABCDG).

Limitations in Current Knowledge

  • Functional Studies: No peer-reviewed studies explicitly investigating RnfE’s role in C. sakazakii virulence or metabolism are cited in the provided sources.

  • Structural Data: Crystallographic or cryo-EM structures of RnfE are absent, limiting mechanistic insights.

  • Regulatory Networks: Unknown how RnfE expression is regulated (e.g., under iron limitation or oxidative stress).

Proposed Research Areas

  1. Pathogenicity Link:

    • Investigate whether RnfE contributes to C. sakazakii’s survival in low-moisture environments (e.g., powdered infant formula).

  2. Therapeutic Targeting:

    • Screen small molecules inhibiting RnfE activity to disrupt bacterial energy metabolism.

  3. Comparative Genomics:

    • Compare RnfE conservation across Cronobacter species to identify niche-specific adaptations.

References and Data Sources

  1. Product Specifications:

    • CBM15 ELISA Recombinant Protein Product Page .

  2. Structural Context:

    • General electron transport complex literature (not directly cited in sources).

  3. Applications:

    • Aviva Systems Biology Recombinant Protein Protocol Guidelines .

Note: The absence of direct citations to functional studies highlights the need for targeted research on RnfE.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
rnfE; ESA_01991; Ion-translocating oxidoreductase complex subunit E; Rnf electron transport complex subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-228
Protein Length
full length protein
Species
Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)
Target Names
ESA_01991
Target Protein Sequence
MNDVKSILVNGLWKNNSALVQLLGMCPLLAVTSTATNALGLGLATTLVLTLTNASISAFR RWMPGEIRIPIYVMIIAAVVSIVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KNGPLLSALDGFAIGLGATGAMFVLGSLREILGNGTLFDGADGLLGSWARVLRIEVFHTD TPFLLAMLPPGAFIGLGMMLAVKYLIDERMKRRAAKPVVVEAAAEKAS
Uniprot No.

Target Background

Function
This protein is a component of a membrane-bound complex that facilitates the coupling of electron transfer with the translocation of ions across the membrane.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the RnfE protein in Cronobacter sakazakii and what is its primary function?

RnfE is a component of the membrane-bound electron transport complex in Cronobacter sakazakii. It functions as part of the Rnf (Rhodobacter nitrogen fixation) complex, which is involved in electron transport and energy conservation. In C. sakazakii, electron transport complex proteins (including those similar to RnfE, such as ESA_01988, ESA_01989, and ESA_01990) appear to be differentially expressed between strains with varying degrees of virulence. These proteins form part of the membrane complex involved in electron transport and may contribute to the organism's metabolic activity and energy production capabilities . The high expression of electron transport complex proteins has been associated with increased adhesion and invasion capabilities in certain strains of C. sakazakii.

What are the most effective methods for expressing and purifying recombinant C. sakazakii RnfE protein?

For effective expression and purification of recombinant C. sakazakii RnfE, researchers should consider the following methodological approach:

  • Expression System Selection:

    • E. coli BL21(DE3) is often the preferred host for membrane protein expression

    • Consider using specialized strains designed for membrane protein expression when dealing with challenging proteins

  • Vector Design:

    • Include affinity tags (His6, GST, or MBP) for purification purposes

    • Consider codon optimization for E. coli expression

    • Include TEV protease cleavage sites for tag removal if necessary

  • Expression Conditions:

    • Lower induction temperatures (16-25°C) may improve folding of membrane proteins

    • Induction with lower IPTG concentrations (0.1-0.5 mM) can reduce inclusion body formation

    • Expression in the presence of membrane-mimetic environments may enhance protein stability

  • Membrane Protein Extraction:

    • Use gentle detergents for solubilization (DDM, LDAO, or Triton X-100)

    • Consider nanodisc or liposome reconstitution for functional studies

  • Purification Strategy:

    • Immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography

    • On-column detergent exchange during purification if necessary

    • Verify protein purity using SDS-PAGE and Western blotting

Successful purification should be confirmed by mass spectrometry analysis, with expected yields varying based on expression conditions and protein characteristics.

What challenges are typically encountered when working with recombinant RnfE and how can they be overcome?

Researchers working with recombinant RnfE from C. sakazakii often encounter several technical challenges:

  • Protein Instability Issues:

    • Challenge: RnfE, being a membrane protein, may exhibit instability when extracted from its native environment

    • Solution: Incorporate stabilizing agents such as glycerol (10-15%) in buffers and maintain strict temperature control during purification

  • Solubility Limitations:

    • Challenge: Low solubility and tendency to form inclusion bodies

    • Solution: Screen multiple detergents at various concentrations; consider fusion partners that enhance solubility (e.g., MBP, SUMO); explore extraction under varying pH conditions

  • Functional Reconstitution Difficulties:

    • Challenge: Maintaining the functional state of RnfE outside its native membrane environment

    • Solution: Reconstitute into nanodiscs or liposomes composed of lipids that mimic bacterial membranes; employ functional assays immediately after purification

  • Expression Level Variability:

    • Challenge: Inconsistent expression levels between batches

    • Solution: Standardize growth conditions; consider auto-induction media; optimize cell density at induction time

  • Co-purification of Contaminants:

    • Challenge: Co-purification with other components of the Rnf complex or interacting proteins

    • Solution: Implement stringent washing steps during affinity chromatography; utilize tandem purification approaches with orthogonal tags; consider on-column refolding methods

These challenges can be monitored and addressed through careful experimental design and quality control checks at each stage of the process.

How does RnfE expression correlate with virulence in different C. sakazakii strains?

Comparative proteomic analysis of C. sakazakii strains with different adhesion/invasion capabilities has revealed a significant correlation between electron transport complex proteins and virulence. While RnfE specifically was not directly mentioned in the studies, related electron transport complex proteins showed the following patterns:

  • Expression Patterns in Virulent Strains:

    • Electron transport complex proteins were exclusively expressed in strongly adhesive/invasive strains compared to weakly adhesive/invasive strains with the same sequence type (ST)

    • Proteins ESA_01988, ESA_01989, and ESA_01990, which function similarly to RnfE as part of the membrane complex involved in electron transport, were only detected in the highly virulent strain SAKA80220

  • Correlation with Metabolic Activity:

    • The high expression of these proteins indicates elevated metabolic activity in virulent strains

    • Enhanced energy production appears to support adhesion to and invasion of host cells

  • Association with Other Virulence Factors:

    • Expression of electron transport proteins correlates with other virulence-associated factors including:

      • Flagellar assembly components

      • Lipopolysaccharide synthesis proteins

      • LuxS/AI-2 quorum sensing system components

      • Iron-sulfur cluster proteins

This pattern suggests that RnfE and related electron transport proteins may be important bioenergetic contributors to C. sakazakii virulence, potentially serving as markers for strains with enhanced pathogenic potential.

What metabolic pathways are affected by RnfE function in C. sakazakii?

RnfE, as a component of the electron transport complex, influences several critical metabolic pathways in C. sakazakii:

  • Energy Generation Pathways:

    • Facilitates electron transfer and energy conservation

    • Contributes to proton motive force generation for ATP synthesis

    • May support NADH:ferredoxin oxidoreductase activity

  • Redox Balance Regulation:

    • Maintains cellular redox homeostasis by mediating electron flow

    • Potentially supports ferredoxin-dependent reactions

    • Could influence NAD⁺/NADH ratios within the cell

  • Nitrogen Metabolism:

    • May play a role in nitrogen fixation or nitrogen compound utilization

    • Could influence ammonia assimilation pathways

  • Adaptative Metabolism:

    • Supports metabolic adaptation to different environmental niches

    • May facilitate transitions between aerobic and anaerobic metabolism

    • Could enable utilization of alternative energy sources during host infection

The expression of electron transport complex proteins, including those functionally similar to RnfE, appears to be associated with enhanced metabolic activity that supports virulence properties such as adhesion and invasion . This suggests that RnfE may provide the bioenergetic foundation necessary for pathogenic behaviors.

How does recombination affect RnfE gene expression and function across different C. sakazakii lineages?

Recombination plays a significant role in the evolution and diversification of C. sakazakii, potentially affecting RnfE expression and function across different lineages:

  • Recombination Impact on Gene Expression:

    • Studies have shown that approximately 2,991 genes in the C. sakazakii pan-genome have a history of recombination

    • Many frequently recombined genes are associated with nutrient acquisition, metabolism, and toxin production

    • While RnfE isn't specifically mentioned, genes involved in metabolic processes similar to electron transport are frequent targets of recombination

  • Lineage-Specific Variations:

    • Phylogenetic analyses reveal at least ten deep branching monophyletic lineages in C. sakazakii, indicating ancestral diversification

    • Different lineages may exhibit variable recombination rates, potentially creating "recombination hubs"

    • Such variation can affect the expression and function of metabolic genes including those in electron transport complexes

  • Functional Consequences:

    • Recombination events may lead to the acquisition of novel gene variants with altered functions

    • These events could result in modified electron transport efficiency or substrate specificity

    • Potential acquisition of regulatory elements affecting RnfE expression patterns

Research examining the specific recombination patterns of RnfE across multiple C. sakazakii lineages would provide valuable insights into how genetic exchange influences the functional diversity of this important electron transport protein and its potential role in pathogenicity.

What is the three-dimensional structure of RnfE and how does it interact with other components of the electron transport complex?

While the specific three-dimensional structure of C. sakazakii RnfE has not been fully elucidated, predictions can be made based on homologous proteins and general characteristics of electron transport complex components:

  • Predicted Structural Features:

    • RnfE likely contains multiple transmembrane domains as a membrane-embedded component

    • Probable presence of conserved iron-sulfur binding motifs

    • Potential dimerization or oligomerization interfaces for complex formation

    • Likely contains regions for interaction with other Rnf complex subunits

  • Interaction with Rnf Complex Components:

    • RnfE is expected to form part of a larger membrane-bound complex that typically includes RnfA, RnfB, RnfC, RnfD, RnfG proteins

    • Specific protein-protein interaction domains would facilitate complex assembly

    • Electron transfer likely occurs through precisely positioned redox centers

  • Functional Domains:

    • Redox-active centers for electron transfer

    • Substrate binding sites

    • Regions involved in proton translocation

    • Potential regulatory binding sites

For comprehensive structural characterization, researchers should consider:

  • X-ray crystallography of the purified protein (challenging for membrane proteins)

  • Cryo-electron microscopy to visualize the entire complex

  • NMR spectroscopy for dynamic structural elements

  • Molecular dynamics simulations to predict conformational changes during electron transfer

A detailed structural understanding would greatly enhance our knowledge of how RnfE contributes to energy conservation and potentially to virulence in C. sakazakii.

What gene knockout or silencing approaches are most effective for studying RnfE function in C. sakazakii?

Several genetic manipulation approaches can be employed to study RnfE function in C. sakazakii, each with specific advantages and considerations:

  • CRISPR-Cas9 System:

    • Currently the most precise method for gene knockout

    • Design considerations:

      • Select target sequences with minimal off-target effects

      • Use C. sakazakii-optimized Cas9 expression systems

      • Employ homology-directed repair for precise gene deletion

    • Verification by sequencing and expression analysis is essential

  • Homologous Recombination-Based Methods:

    • Traditional approach using suicide vectors

    • Protocol elements:

      • Design vectors with 500-1000 bp homology arms flanking the rnfE gene

      • Include selectable markers (antibiotic resistance genes)

      • Consider counter-selection strategies for marker removal

    • Requires rigorous screening for successful recombinants

  • Transposon Mutagenesis:

    • Useful for generating libraries of mutants

    • Implementation strategy:

      • Use Tn5 or mariner-based transposons for random insertions

      • Screen for insertions in rnfE using PCR-based methods

      • Confirm disruption through expression analysis

    • Less precise but technically simpler than targeted approaches

  • Antisense RNA Technology:

    • For conditional or partial silencing

    • Design parameters:

      • Target regions critical for translation initiation

      • Use inducible promoters for controlled expression

      • Consider stability and secondary structure of antisense molecules

    • Allows for studying essential genes where knockout may be lethal

  • Inducible Degradation Systems:

    • For temporal control of protein levels

    • Implementation:

      • Tag RnfE with degron sequences

      • Use chemical inducers to trigger controlled degradation

      • Monitor degradation kinetics and phenotypic changes

    • Useful for studying immediate effects of protein removal

For each approach, complementation studies should be performed to confirm that observed phenotypes are specifically due to RnfE disruption and not polar effects or secondary mutations.

What are the best experimental designs for studying the contribution of RnfE to C. sakazakii virulence in vitro and in vivo?

Robust experimental designs for investigating RnfE's contribution to C. sakazakii virulence should incorporate both in vitro and in vivo approaches:

In Vitro Experimental Designs:

  • Cell Adhesion and Invasion Assays:

    • Compare wild-type and rnfE mutant strains using:

      • Human intestinal epithelial cells (Caco-2, HT-29)

      • Human brain microvascular endothelial cells (HBMEC)

    • Quantification methods:

      • Gentamicin protection assay for invasion rate determination

      • Differential immunofluorescence staining for adhesion/invasion distinction

      • Real-time monitoring using impedance-based systems

  • Biofilm Formation Assessment:

    • Crystal violet staining of biofilms formed in microtiter plates

    • Confocal laser scanning microscopy with live/dead staining

    • Flow cell systems for dynamic biofilm development monitoring

  • Stress Response Evaluation:

    • Survival under various stressors (pH extremes, desiccation, oxidative stress)

    • Measurement of growth kinetics under stress conditions

    • Evaluation of metabolic activity using resazurin or ATP-based assays

In Vivo Experimental Models:

  • Neonatal Mouse Model:

    • Oral gavage of wild-type vs. rnfE mutant

    • Parameters to monitor:

      • Intestinal colonization levels

      • Translocation to blood and organs

      • Histopathological changes

      • Inflammatory markers

      • Survival rates

  • Zebrafish Embryo Model:

    • Microinjection into circulation or yolk sac

    • Real-time visualization of infection progression

    • Evaluation of immune response

  • Galleria mellonella (Wax Moth) Larvae:

    • Injection of bacterial suspensions

    • Monitoring of survival, melanization, and bacterial burden

    • Suitable for high-throughput preliminary screening

Experimental Controls and Validation:

  • Complementation Studies:

    • Include rnfE-complemented mutant strain

    • Use controlled expression systems to prevent artifacts from overexpression

  • Multi-omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Correlate gene expression changes with observed phenotypes

  • Competitive Index Assays:

    • Co-infection with wild-type and mutant strains

    • Direct comparison of fitness in the same host environment

How does C. sakazakii RnfE differ from homologous proteins in other bacterial species?

The RnfE protein in C. sakazakii exhibits several key differences from its homologs in other bacterial species, with implications for function and potential as a therapeutic target:

  • Sequence Divergence:

    • While maintaining core functional domains, C. sakazakii RnfE shows sequence variations in:

      • Transmembrane spanning regions

      • Charged residues involved in ion translocation

      • Potential regulatory sites

    • These variations may reflect adaptation to the specific metabolic requirements of C. sakazakii

  • Expression Pattern Differences:

    • Unlike some other bacteria where Rnf complex proteins are constitutively expressed, in C. sakazakii the expression appears to correlate with virulence potential

    • Electron transport complex proteins are differentially expressed between strongly and weakly adhesive/invasive strains of C. sakazakii

  • Functional Associations:

    • In C. sakazakii, RnfE and related electron transport proteins show associations with:

      • Enhanced metabolism supporting adhesion/invasion processes

      • Potential involvement in niche-specific adaptation

    • This differs from some other bacteria where Rnf complexes are primarily involved in basic energy conservation

  • Evolutionary Context:

    • The extensive recombination detected in C. sakazakii genomes (2,991 genes with recombination history) suggests RnfE may have been subject to genetic exchange

    • This contrasts with more conserved Rnf complex genes in some other bacterial species

Understanding these differences is crucial for potentially targeting RnfE in therapeutic approaches and for understanding the specific adaptations of C. sakazakii to its environmental niches and pathogenic lifestyle.

What functional assays can be used to measure RnfE activity in membrane preparations or reconstituted systems?

Assessing RnfE activity requires specialized techniques that account for its membrane-bound nature and electron transport function:

  • Electron Transfer Measurements:

    • Spectrophotometric Assays:

      • Monitor reduction/oxidation of artificial electron acceptors/donors

      • Track NAD⁺/NADH conversion at 340 nm

      • Measure ferredoxin reduction/oxidation at appropriate wavelengths

    • Oxygen Consumption Assays:

      • Use oxygen electrodes to measure electron transport to oxygen

      • Compare rates in wild-type vs. rnfE mutant membrane preparations

  • Membrane Potential Measurements:

    • Voltage-Sensitive Dyes:

      • DiSC3(5) or JC-1 for membrane potential visualization

      • Quantitative fluorescence measurements to compare wild-type and mutant preparations

    • Ion Flux Measurements:

      • Use ion-selective electrodes to measure proton translocation

      • Incorporate radio-labeled ions to track movement across membranes

  • Reconstituted System Approaches:

    • Proteoliposome Assays:

      • Incorporate purified RnfE (or complete Rnf complex) into liposomes

      • Measure vectorial electron transfer and ion translocation

      • Assess substrate specificity using various electron donors/acceptors

    • Nanodiscs Systems:

      • Reconstitute RnfE into nanodiscs for structural and functional studies

      • Combine with surface plasmon resonance for interaction studies

  • Whole-Cell Approaches:

    • Membrane Fraction Activity:

      • Isolate membrane fractions from wild-type and rnfE mutant strains

      • Compare electron transport activities with various substrates

      • Conduct inhibitor studies to characterize specific activities

Assay TypeMeasurementsAdvantagesLimitations
SpectrophotometricNAD⁺/NADH conversion, artificial electron acceptor reductionQuantitative, relatively simple setupMay not reflect native electron flow
Oxygen ConsumptionO₂ uptake rates, respiratory chain activityDirect measure of electron transport to O₂Limited to aerobic aspects of function
Membrane PotentialProton gradients, membrane energizationDirectly assesses energy conservationTechnical challenges in measurement accuracy
ProteoliposomeVectorial electron transfer, ion movementsControlled environment for mechanistic studiesComplex reconstitution process
Nanodisc SystemProtein-protein interactions, structural dynamicsMaintains native-like lipid environmentRequires specialized equipment and expertise

These assays provide complementary information and should be selected based on the specific aspects of RnfE function being investigated.

How might RnfE be targeted for antimicrobial development against C. sakazakii?

RnfE represents a potential target for novel antimicrobial strategies against C. sakazakii based on several favorable characteristics:

  • Target Validation Rationale:

    • Electron transport complex proteins are associated with virulence in C. sakazakii

    • RnfE likely contributes to energy metabolism required for pathogenesis

    • Targeting energy production systems can broadly affect multiple virulence mechanisms

  • Inhibitor Development Strategies:

    • Structure-Based Design:

      • Once the 3D structure is determined, design compounds that:

        • Block electron flow through the complex

        • Interfere with protein-protein interactions in the Rnf complex

        • Disrupt membrane integration or complex assembly

    • High-Throughput Screening:

      • Develop activity assays suitable for screening compound libraries

      • Focus on compounds that selectively inhibit bacterial rather than mammalian electron transport

  • Potential Inhibitor Classes:

    • Small molecules targeting cofactor binding sites

    • Peptidomimetics that disrupt protein-protein interactions

    • Membrane-active compounds that affect complex integrity

    • Allosteric modulators affecting conformational changes required for activity

  • Delivery Approaches:

    • Nanoparticle-based delivery systems for hydrophobic inhibitors

    • Siderophore-conjugated inhibitors for active transport into bacterial cells

    • Prodrug approaches to enhance cellular penetration

  • Resistance Mitigation Strategies:

    • Combination with conventional antibiotics

    • Multi-target inhibitors affecting several components of the electron transport chain

    • Development of inhibitors with high barriers to resistance development

The feasibility of targeting RnfE is supported by the success of other respiratory chain inhibitors in clinical use, such as bedaquiline for Mycobacterium tuberculosis treatment, which targets ATP synthase. Research should focus on identifying compounds with selectivity for bacterial versus human electron transport systems to minimize toxicity concerns.

What role might RnfE play in C. sakazakii adaptation to different environmental niches, including food production environments?

RnfE likely contributes significantly to C. sakazakii's remarkable ability to adapt to diverse environmental niches:

  • Arid Environment Survival:

    • C. sakazakii is known for its ability to survive in extremely arid environments, including powdered infant formula

    • RnfE may contribute to energy conservation during desiccation stress

    • Could support metabolic flexibility required for dormancy and resuscitation

  • Stress Response Integration:

    • Environmental adaptation requires coordinated stress responses

    • RnfE may support:

      • Maintenance of membrane potential during stress

      • Energy provision for stress response mechanisms

      • Redox balance during oxidative stress

  • Food Production Environment Adaptation:

    • Temperature Fluctuations:

      • RnfE might enable energy production under varying temperature conditions

      • Could support metabolic shifts during thermal stress

    • Nutrient Limitation:

      • Alternative electron transport pathways may allow utilization of diverse energy sources

      • Support for metabolic flexibility in nutrient-poor settings

  • Biofilm Formation Support:

    • Biofilms are crucial for survival in food production environments

    • RnfE may contribute to:

      • Energy requirements during initial attachment phases

      • Metabolic coordination within biofilm communities

      • Persistence during cleaning and disinfection procedures

  • Niche-Specific Gene Expression:

    • Comparative studies show that C. sakazakii exhibits niche-specific gene expression patterns

    • Environment-exclusive accessory genes show enrichment for metabolic functions

    • RnfE expression may be regulated in response to specific environmental conditions

Understanding RnfE's role in environmental adaptation could inform improved strategies for controlling C. sakazakii in food production settings, particularly in infant formula manufacturing environments where contamination poses significant health risks to vulnerable populations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.