Recombinant Cronobacter sakazakii Electron transport complex protein RnfG (rnfG)

Shipped with Ice Packs
In Stock

Description

Introduction

Cronobacter sakazakii is a foodborne pathogen that can cause severe illnesses in infants, such as septicemia, meningitis, and necrotizing enterocolitis . Recombinant Cronobacter sakazakii Electron Transport Complex Protein RnfG (rnfG) is a component of the Rnf complex, an ion-motive electron transport chain that couples cellular ferredoxin to the pyridine nucleotide pool . The Rnf complex is involved in electron transfer and ion translocation across the membrane .

Characteristics of Recombinant RnfG Protein

Recombinant Full Length Cronobacter sakazakii Electron Transport Complex Protein RnfG(rnfG) Protein with a His-Tag, is expressed in E. coli . The protein's amino acid sequence spans from 1 to 208 and it has the UniProt accession number A7MML1 .

Function and Significance of the Rnf Complex

The Rnf complex is a membrane-bound complex that couples electron transfer with the translocation of ions across the membrane . RnfG is a component of this complex, which is required to maintain the reduced state of certain cellular components .

The Rnf complex functions as a sodium-translocating ferredoxin:NAD+ oxidoreductase . It catalyzes primary sodium transport energized by electron flow from ferredoxin to NAD+ .

RnfG in Adhesion and Invasion

A study investigating proteomic profiles of C. sakazakii identified six specific proteins expressed in a strong-adhesive/invasive strain, including three electron transport complex proteins: ESA_01988, ESA_01989, and ESA_01990 . These proteins, including RnfG, are part of the membrane complex involved in electron transport . Their high expression suggests that the strong-adhesive/invasive strain has high metabolic activity, and the additional stored energy might aid adhesion to or invasion of host cells .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
rnfG; ESA_01990; Ion-translocating oxidoreductase complex subunit G; Rnf electron transport complex subunit G
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-208
Protein Length
full length protein
Species
Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)
Target Names
ESA_01990
Target Protein Sequence
MLKTIQKHGVTLAVFAALTTGLTAMVNALTKTTIEGQAALQQKQLFDQVLPPEMYDNDIQ QSCYLVSAPALGRGEKQLWVARKGDTPVAVVMQATAPDGYSGAIQLLVGADFKGTVLGTR VTEHHETPGLGDKIETRISDWITGFAGQVIHGPNDTRWAVKKDGGQFDQFTGATITPRAV VNAVKRAGLYAQTLEPQLSTLPSCGENP
Uniprot No.

Target Background

Function
A component of a membrane-bound complex responsible for coupling electron transfer with ion translocation across the membrane.
Database Links
Protein Families
RnfG family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

How does RnfG fit into the electron transport system of Cronobacter sakazakii?

RnfG operates alongside RnfC (ESA_01988) and RnfD (ESA_01989) as part of the electron transport complex. This system is involved in energy metabolism, where the Rnf complex functions as an ion-translocating oxidoreductase. Research indicates that in strong-adhesive/invasive strains of C. sakazakii, this complex shows heightened expression, suggesting that increased metabolic activity and energy production may facilitate host cell adhesion and invasion . Methodologically, researchers studying this relationship typically employ proteomic approaches like data-independent acquisition (DIA) analysis to quantify differential protein expression between strains with varying virulence characteristics.

What is the structural classification of RnfG protein?

The RnfG protein belongs to the electron transport complex protein family. It contains a transmembrane domain and is characterized as a membrane-bound protein. Structural analysis methods including hydropathy plots and transmembrane domain prediction algorithms suggest it has membrane-spanning regions consistent with its role in electron transport. For researchers seeking to investigate its structure, a combination of computational prediction methods and experimental approaches such as circular dichroism spectroscopy would be recommended to evaluate secondary structure elements. More advanced structural characterization would require X-ray crystallography or cryo-electron microscopy techniques, though no published high-resolution structure is currently available for C. sakazakii RnfG.

What are the optimal conditions for expressing recombinant RnfG protein?

Recombinant RnfG from C. sakazakii can be expressed in E. coli expression systems using vectors such as pET-26b(+). Based on methodologies used for similar membrane proteins from Cronobacter:

  • Expression System Optimization:

    • Host strain: E. coli BL21(DE3) typically yields good results

    • Vector: pET series vectors with His-tag fusion for purification

    • Induction: 0.05-0.5 mM IPTG at OD600 of 0.6-0.8

    • Temperature: 30°C for 4-8 hours (reduced temperature improves folding)

  • Protein Solubilization:

    • Given its membrane association, detergent solubilization using mild detergents (DDM, LDAO) is often necessary

    • Cell disruption via high-pressure homogenization at 25 MPa has shown good results for Cronobacter membrane proteins

The methodology for expression should include optimization of these parameters through small-scale expression trials before scaling up.

What purification strategy is most effective for recombinant RnfG?

A multi-step purification approach is recommended:

  • Initial Capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin for His-tagged RnfG

  • Intermediate Purification: Ion exchange chromatography (typically anion exchange)

  • Polishing Step: Size exclusion chromatography for final purity

Researchers should monitor purification efficiency at each step using SDS-PAGE. For RnfG specifically, maintaining the detergent concentration above CMC (critical micelle concentration) throughout purification is crucial to prevent protein aggregation. If the protein forms inclusion bodies, a denaturation and renaturation protocol using 8M urea followed by step-wise dialysis may be employed, similar to methods described for other Cronobacter membrane proteins .

How can I verify the identity and integrity of purified recombinant RnfG?

Multiple analytical methods should be employed:

  • SDS-PAGE: To confirm molecular weight (~23 kDa plus tag)

  • Western Blotting: Using anti-His antibodies or RnfG-specific antibodies

  • Mass Spectrometry: For precise mass determination and peptide fingerprinting

  • N-terminal Sequencing: To confirm correct processing, particularly if signal peptide removal is expected

  • Functional Assays: Electron transport activity assays using artificial electron donors/acceptors

For quality control purposes, researchers should establish acceptance criteria for each analytical method. Mass spectrometry-based approaches are particularly valuable for confirming post-translational modifications that may affect protein function.

How can I assess the electron transport activity of recombinant RnfG?

To characterize the electron transport function of RnfG:

  • Reconstitution System: Incorporate purified RnfG into liposomes or nanodiscs along with other Rnf complex components

  • Electron Transfer Assays:

    • Measure electron transfer using spectrophotometric methods with redox-sensitive dyes

    • Monitor reduction of artificial electron acceptors (e.g., ferricyanide, cytochrome c)

  • Membrane Potential Measurements:

    • Use voltage-sensitive fluorescent dyes (e.g., DiSC3(5)) to monitor ion translocation

    • Employ patch-clamp techniques on reconstituted proteoliposomes

Control experiments should include inactive protein variants (e.g., site-directed mutants affecting key residues) and assays performed in the presence of specific inhibitors of electron transport.

What is the relationship between RnfG expression and virulence in Cronobacter sakazakii?

Proteomic studies have identified RnfG as one of six specific proteins expressed only in strong-adhesive/invasive strains of C. sakazakii. The data suggests:

  • Differential Expression: RnfG protein (ESA_01990) shows significantly higher expression in strongly adhesive/invasive strains compared to weakly adhesive/invasive strains

  • Metabolic Connection: Enhanced expression of electron transport proteins, including RnfG, correlates with increased metabolic activity

  • Energy Requirement Hypothesis: Higher energy production facilitated by RnfG may support mechanisms required for host cell adhesion and invasion

StrainAdhesion CapabilityRnfG ExpressionOther Electron Transport Proteins
SAKA80220StrongPresentRnfC, RnfD also present
SAKA80221WeakAbsentRnfC, RnfD also absent

Research methodologies to investigate this relationship further would include:

  • Gene knockout studies to create ΔrnfG mutants and assess virulence changes

  • Complementation studies to restore function and confirm phenotypic effects

  • In vivo infection models to evaluate pathogenicity differences

How does RnfG contribute to Cronobacter sakazakii survival in hostile environments?

C. sakazakii is known for its remarkable ability to survive in extremely dry environments such as powdered infant formula (PIF). Research indicates that proteins involved in energy metabolism, including electron transport complexes, may contribute to this survival capability:

  • Stress Response Connection: Electron transport proteins are often upregulated during environmental stress conditions

  • Energy Conservation: The Rnf complex may help maintain minimal energy production during desiccation stress

  • Osmotic Stress Management: The ion-translocating function may contribute to maintaining ion homeostasis during osmotic stress

Methodologically, researchers can investigate these connections through:

  • Transcriptomic analysis comparing expression under normal vs. stress conditions

  • Survival assays comparing wild-type and rnfG mutant strains under desiccation stress

  • Metabolomic profiling to assess energy metabolism changes during stress response

How can recombinant RnfG be used for developing detection methods for Cronobacter sakazakii?

Recombinant RnfG protein can be utilized in multiple detection strategies:

  • Antibody Development:

    • Purified recombinant RnfG can be used to raise polyclonal or monoclonal antibodies

    • These antibodies can be employed in immunoassays (ELISA, lateral flow) for detecting C. sakazakii in food samples

    • Sensitivity can be enhanced through sandwich ELISA formats

  • Molecular Detection:

    • PCR primers targeting the rnfG gene can be designed for specific detection

    • The rnfG gene sequence can be incorporated into multiplex PCR assays

    • DNA microarray approaches can include rnfG probes as part of a comprehensive detection panel

  • Aptamer Development:

    • Recombinant RnfG can serve as a target for SELEX (Systematic Evolution of Ligands by Exponential Enrichment)

    • Resulting aptamers can be incorporated into biosensor platforms

For researchers developing detection methods, combining multiple targets (including RnfG) increases specificity for C. sakazakii identification in complex matrices like powdered infant formula.

What are the potential applications of RnfG in vaccine development against Cronobacter infections?

RnfG may have potential as a vaccine component due to several characteristics:

  • Surface Exposure: As a membrane protein, portions of RnfG may be exposed on the bacterial surface

  • Association with Virulence: Its correlation with adhesive/invasive phenotypes suggests relevance to pathogenicity

  • Conservation: Sequence analysis indicates conservation across Cronobacter strains

Research approaches for vaccine development would include:

  • Immunogenicity Assessment:

    • Animal immunization with purified RnfG to evaluate antibody response

    • Epitope mapping to identify immunodominant regions

    • T-cell response characterization

  • Protection Studies:

    • Challenge studies in animal models using active or passive immunization

    • Evaluation of bacterial load reduction and survival rates

  • Combination Approaches:

    • Testing RnfG in conjunction with other immunogenic proteins

    • Incorporation into multicomponent subunit vaccines

Preliminary research has shown that recombinant proteins from Cronobacter can provide protective effects when used in immunization protocols . Similar approaches could be applied to evaluate RnfG's potential.

How does the genetic variability of rnfG gene affect virulence across different Cronobacter sakazakii strains?

Analysis of genetic diversity in the rnfG gene requires sophisticated methodological approaches:

  • Comparative Genomics:

    • Whole genome sequencing of multiple strains with varying virulence profiles

    • Analysis of single nucleotide polymorphisms (SNPs) within the rnfG gene

    • Assessment of synteny and genomic context across strains

  • Structure-Function Analysis:

    • Identification of critical domains through site-directed mutagenesis

    • Expression of variant proteins to assess functional changes

    • Computational modeling to predict effects of amino acid substitutions

  • Population Genetics:

    • Calculation of selection pressures (dN/dS ratios) on the rnfG gene

    • Analysis of horizontal gene transfer events

    • Assessment of microdiversity within specific sequence types

Research has shown that strain-specific differences in virulence-associated genes exist within Cronobacter species. For example, sequence type ST4 is predominantly associated with neonatal meningitis cases . Investigating rnfG variation within these specific lineages would provide valuable insights into its role in virulence determination.

What is the interplay between RnfG and other virulence factors in Cronobacter sakazakii pathogenicity?

Understanding the complex interactions between different virulence factors requires systems biology approaches:

  • Multi-omics Integration:

    • Correlation of transcriptomic, proteomic, and metabolomic data

    • Network analysis to identify functional relationships

    • Temporal profiling during infection process

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation to identify interacting partners

    • Bacterial two-hybrid assays to map interaction networks

    • Blue native PAGE to identify native protein complexes

  • Regulatory Network Analysis:

    • Investigation of transcriptional regulators affecting rnfG expression

    • Identification of environmental signals modulating expression

    • Analysis of post-transcriptional regulation mechanisms

Research has identified several virulence factors in C. sakazakii, including OmpA, OmpX, adhesins, and iron acquisition systems . The electron transport function of RnfG may provide energy required for expression or function of these factors. A systems-level approach would be necessary to decipher these complex relationships.

How can structural biology approaches advance our understanding of RnfG function and potential inhibition strategies?

Advanced structural biology techniques can reveal critical insights:

  • Structure Determination:

    • X-ray crystallography of purified RnfG protein

    • Cryo-electron microscopy of the entire Rnf complex

    • NMR spectroscopy for dynamic structural elements

  • Structure-Based Drug Design:

    • Virtual screening against resolved structures

    • Fragment-based drug discovery approaches

    • Structure-activity relationship studies of identified inhibitors

  • Functional Validation:

    • Site-directed mutagenesis of key residues identified from structures

    • Biophysical characterization of protein-inhibitor interactions

    • In vitro and in vivo testing of structure-guided inhibitors

While no high-resolution structure of C. sakazakii RnfG is currently available, research on homologous proteins from other bacteria suggests that the Rnf complex forms a membrane-embedded assembly with multiple subunits. Structural studies would be particularly valuable for identifying potential druggable sites that could be targeted to disrupt energy metabolism in this pathogen.

What are the major challenges in working with recombinant membrane proteins like RnfG?

Researchers face several technical challenges when working with membrane proteins like RnfG:

  • Expression Hurdles:

    • Low expression levels compared to soluble proteins

    • Toxicity to host cells when overexpressed

    • Inclusion body formation

  • Solubilization Difficulties:

    • Finding appropriate detergents that maintain native structure

    • Detergent-mediated interference with downstream applications

    • Protein aggregation during concentration steps

  • Functional Reconstitution:

    • Complexity of membrane insertion for functional studies

    • Loss of interacting partners present in native membrane

    • Difficulty reproducing native lipid environment

Methodological solutions include:

  • Using specialized expression systems (C41/C43 E. coli strains designed for membrane proteins)

  • Employing fusion partners that enhance folding and solubility

  • Testing multiple detergent types and concentrations

  • Utilizing membrane mimetics like nanodiscs or amphipols

  • Developing cell-free expression systems specifically optimized for membrane proteins

How can I troubleshoot low yields in recombinant RnfG production?

Systematic troubleshooting approaches include:

  • Transcriptional Level Issues:

    • Verify mRNA levels by RT-PCR

    • Test different promoter strengths

    • Analyze codon usage and optimize if necessary

  • Translational Level Problems:

    • Examine translation initiation efficiency

    • Consider adding translation enhancers

    • Optimize ribosome binding sites

  • Post-translational Challenges:

    • Assess protein stability with and without protease inhibitors

    • Monitor inclusion body formation with and without solubility tags

    • Test expression at reduced temperatures (16-25°C)

  • Purification Optimization:

    • Evaluate different lysis methods (chemical versus mechanical)

    • Test alternative detergents for membrane extraction

    • Optimize buffer compositions to enhance stability

A methodical approach to identifying bottlenecks in the production pipeline, combined with small-scale optimization experiments, can significantly improve yields of functional recombinant RnfG protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.