Recombinant Cronobacter sakazakii Fumarate reductase subunit D (frdD)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Cronobacter sakazakii Fumarate Reductase Subunit D (frdD) is a hydrophobic membrane protein encoded by the frdD gene (UniProt ID: A7MMB3). It serves as a structural component of the fumarate reductase complex (QFR), anchoring the catalytic subunits to the inner cell membrane and facilitating quinone interaction . Unlike its catalytic counterparts (subunits A, B, and C), frdD does not directly participate in electron transfer but is essential for stabilizing the enzyme’s architecture and enabling anaerobic respiration .

Subunit Interactions

frdD interacts with subunits C and A/B to form a functional QFR complex. In E. coli, separating the DNA encoding subunits C and D prevents proper assembly, underscoring frdD’s role in structural integrity .

Electron Transfer Mechanism

While frdD does not directly facilitate electron transfer, it ensures proximity between:

  1. Quinol (bound to subunit C)

  2. Iron-sulfur clusters (subunit B)

  3. FAD (subunit A)

This spatial arrangement enables efficient electron flow from quinol to fumarate, reducing it to succinate .

Metabolic Studies

frdD is critical for Cronobacter sakazakii’s anaerobic metabolism, particularly in environments with limited oxygen, such as biofilms or host tissues . Its absence disrupts QFR function, impairing fumarate respiration and potentially affecting bacterial survival under stress .

Antimicrobial Resistance

Though not directly linked to antibiotic resistance, frdD’s role in maintaining metabolic homeostasis may influence bacterial persistence in hostile environments. For example, Cronobacter sakazakii’s ability to form biofilms and resist oxidative stress (e.g., photodynamic inactivation) could indirectly rely on robust metabolic pathways like those involving QFR .

Comparative Analysis with SQR

FeatureFumarate Reductase (QFR)Succinate Dehydrogenase (SQR)
Oxygen RequirementAnaerobicAerobic
Electron AcceptorFumarate → SuccinateSuccinate → Fumarate
Subunit CompositionA, B, C, D (frdD anchors C)A, B, C, D (similar structural roles)
Enzymatic ActivityQuinol:fumarate oxidoreductaseSuccinate:quinone oxidoreductase

QFR and SQR share structural homology but differ in catalytic direction and oxygen dependency .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
frdD; ESA_00162; Fumarate reductase subunit D; Fumarate reductase 13 kDa hydrophobic protein; Quinol-fumarate reductase subunit D; QFR subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)
Target Names
frdD
Target Protein Sequence
MINQHPKRSDEPVFWGLFGAGGMWCAIIAPVIIMLVGILLPLGIGPEGAFSYERVLAFAQ SWVGRLFLFLMIVLPLWCGLHRIHHGMHDLKIHVPAGKWVFYGLAAILTVVTLIGVVTL
Uniprot No.

Target Background

Function

Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate: fumarate reductase (used in anaerobic growth) and succinate dehydrogenase (used in aerobic growth). Fumarate reductase subunit D anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.

Database Links
Protein Families
FrdD family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Fumarate reductase subunit D (frdD) in Cronobacter sakazakii?

Fumarate reductase subunit D (frdD) is one of four subunits that constitute the fumarate reductase complex in Cronobacter sakazakii. This 119-amino acid protein with a molecular mass of approximately 13.1 kDa primarily functions as an anchoring component that secures the catalytic elements of the fumarate reductase complex to the cytoplasmic membrane . The protein belongs to the FrdD family and plays a crucial role in the anaerobic respiratory chain of this bacterium.

How does frdD contribute to anaerobic respiration in C. sakazakii?

The frdD subunit is essential for proper localization and function of the fumarate reductase complex, which catalyzes the terminal step in anaerobic respiration when fumarate serves as the final electron acceptor. During anaerobic conditions, this complex performs the reduction of fumarate to succinate, coupled with quinol oxidation, generating energy for the bacterium in oxygen-limited environments . The frdD anchoring function ensures that the catalytic components are correctly positioned within the membrane to facilitate electron transfer from quinol to fumarate, enabling C. sakazakii to survive and grow under anaerobic conditions.

What is the relationship between frdD and other subunits in the fumarate reductase complex?

The fumarate reductase complex typically consists of four subunits (A, B, C, and D), each with specialized functions. While subunit A contains the site for fumarate reduction and subunit B houses iron-sulfur clusters involved in electron transfer, subunits C and D (including frdD) serve as membrane anchors . These hydrophobic subunits secure the catalytic A and B subunits to the cytoplasmic membrane and facilitate quinol binding and oxidation. The complete quaternary structure enables efficient electron transfer from quinol through the iron-sulfur clusters to fumarate, with frdD providing essential structural support for this electron transport chain.

What experimental approaches are recommended for studying frdD structure-function relationships?

To study structure-function relationships of frdD, researchers should consider multiple complementary approaches:

  • Site-directed mutagenesis: Systematically modify conserved residues to identify amino acids essential for membrane insertion, protein-protein interactions, or complex assembly.

  • Protein tagging and localization studies: Use fluorescent or epitope tags to verify membrane localization, ensuring tags don't disrupt native function.

  • Protein-protein interaction assays: Apply techniques such as bacterial two-hybrid systems, co-immunoprecipitation, or crosslinking studies to map interactions between frdD and other fumarate reductase subunits.

  • Structural analysis: While challenging with membrane proteins, techniques like X-ray crystallography or cryo-electron microscopy of the entire complex can provide insights into frdD's structural role.

  • Membrane topology mapping: Use biochemical approaches (protease accessibility or reporter fusions) to determine the orientation and membrane-spanning regions of frdD.

These methodologies, when combined, can elucidate how specific structural elements contribute to frdD's anchoring function within the fumarate reductase complex.

What are optimal strategies for recombinant expression of C. sakazakii frdD?

Expressing membrane proteins like frdD presents unique challenges. Researchers should consider these methodological approaches:

  • Expression system selection:

    • For functional studies: Use bacterial expression systems (modified E. coli strains like C41/C43(DE3) or BL21-AI) designed for membrane protein expression

    • For structural studies: Consider cell-free expression systems that can directly incorporate detergents

  • Vector design considerations:

    • Include a removable fusion tag (His6, MBP, or SUMO) to aid purification

    • Use inducible promoters with tunable expression levels to prevent toxicity

    • Consider codon optimization for the expression host

  • Expression conditions optimization:

    • Lower induction temperatures (16-25°C) to slow expression and allow proper folding

    • Test various induction times and inducer concentrations

    • Supplement with additional membrane components if necessary

  • Co-expression options:

    • Consider co-expressing with chaperones to improve folding

    • For functional studies, co-express all fumarate reductase subunits to promote proper complex assembly

These strategies should be empirically tested and optimized for the specific research goals involving frdD protein .

What purification methods effectively isolate recombinant frdD while maintaining membrane protein integrity?

Purifying membrane proteins like frdD requires specialized techniques:

Purification StageRecommended MethodsCritical Considerations
Membrane extractionDetergent solubilizationTest multiple detergents (DDM, LMNG, LDAO); optimize detergent:protein ratio
Initial captureAffinity chromatographyUse immobilized metal affinity chromatography (IMAC) for His-tagged constructs
Intermediate purificationIon exchange chromatographySelect based on frdD theoretical pI; maintain detergent throughout
PolishingSize exclusion chromatographyAssess oligomeric state and complex formation
Quality controlSDS-PAGE, Western blot, Mass spectrometryVerify purity, identity, and integrity

Throughout purification, maintain stability by controlling temperature (typically 4°C), adding glycerol (10-20%), and ensuring detergent concentration remains above critical micelle concentration. For functional studies, consider using lipid nanodiscs or proteoliposomes to reconstitute frdD into a membrane-like environment post-purification.

How can researchers measure the activity of fumarate reductase complexes containing recombinant frdD?

To assess whether recombinant frdD properly integrates and functions within the fumarate reductase complex, researchers should employ multiple complementary assays:

  • Spectrophotometric enzyme activity assays: Monitor the reduction of fumarate to succinate by tracking changes in absorbance of artificial electron donors/acceptors (e.g., benzyl viologen or methyl viologen). The reaction can be followed at 578 nm as the viologen becomes oxidized during fumarate reduction.

  • Quinol oxidation assays: Measure the oxidation of quinol substrates (menaquinol or duroquinol) coupled to fumarate reduction, using wavelength-specific spectrophotometric methods.

  • Membrane potential measurements: In reconstituted systems, assess the electrochemical gradient generated by the fumarate reductase complex using membrane potential-sensitive fluorescent dyes.

  • Oxygen consumption measurements: Use an oxygen electrode to confirm the anaerobic respiration pathway is functioning correctly when fumarate is provided as the terminal electron acceptor.

  • Fumarate/succinate quantification: Apply HPLC or enzymatic assays to directly measure the conversion of fumarate to succinate in reaction mixtures.

These assays should include appropriate controls, such as complexes lacking frdD or containing mutated versions, to establish the specific contribution of functional frdD to complex activity .

How do mutations in conserved regions of frdD affect fumarate reductase function?

Systematic mutational analysis of frdD conserved regions can reveal structure-function relationships within the fumarate reductase complex:

  • Experimental approach:

    • Generate a library of point mutations targeting conserved residues identified through sequence alignment across bacterial species

    • Express these mutant proteins alongside wild-type subunits A, B, and C

    • Purify the resulting complexes and assess:

      • Complex assembly efficiency

      • Membrane integration

      • Enzyme activity parameters (Km, Vmax, substrate specificity)

      • Stability under various conditions

  • Critical regions to target:

    • Transmembrane helices involved in membrane anchoring

    • Residues at interfaces with other subunits

    • Potential quinol-binding sites

    • Conserved charged or polar residues within membrane domains

  • Analysis methods:

    • Blue Native PAGE to assess complex formation

    • Activity assays as described in 4.1

    • Thermal shift assays to determine stability changes

    • Computational modeling to predict structural impacts

Understanding how specific mutations affect function can provide insights into the precise role of frdD in anchoring and positioning the catalytic components for optimal electron transfer within the anaerobic respiratory chain.

How does C. sakazakii frdD compare with homologous proteins in other bacterial species?

Comparative analysis of frdD across bacterial species reveals important evolutionary and functional patterns:

  • Sequence conservation analysis:
    The frdD protein from C. sakazakii shows moderate sequence conservation with homologs from other Enterobacteriaceae. While hydrophobic transmembrane domains are generally well-conserved functionally (maintaining similar physicochemical properties rather than exact sequence identity), specific residues involved in subunit interactions or quinol binding sites display higher conservation. Particularly, the amino acid composition maintaining the proper membrane topology is preserved across species.

  • Structural comparison:
    Despite sequence variations, the predicted membrane topology of frdD is remarkably conserved across species, typically featuring three transmembrane helices. This conservation underscores the critical importance of the protein's spatial arrangement within the membrane for proper complex assembly and function.

  • Functional differentiation:
    While the basic anchoring function remains conserved, subtle variations in frdD sequences between organisms may reflect adaptations to:

    • Different physiological environments

    • Varying quinol substrates

    • Specific interactions with other respiratory complexes

    • Unique regulatory mechanisms

Researchers investigating C. sakazakii frdD should consider these comparative aspects to identify unique features that might relate to this pathogen's specific metabolic adaptations .

How can recombinant frdD be used to study C. sakazakii anaerobic metabolism?

Recombinant frdD serves as a valuable tool for investigating anaerobic metabolism in C. sakazakii through several research applications:

These approaches contribute to our fundamental understanding of how this significant pathogen survives in diverse environments, including those encountered during food processing and storage .

What is the potential relationship between frdD function and C. sakazakii pathogenicity?

The connection between frdD function and C. sakazakii pathogenicity represents an emerging area of research:

Understanding these relationships could potentially identify new targets for controlling this pathogen with its significant 40-80% mortality rate in certain infections .

What are the challenges and solutions in using recombinant frdD for structural studies?

Structural studies of membrane proteins like frdD face significant technical challenges that require specialized approaches:

ChallengeTechnical SolutionsMethodology Considerations
Protein instability outside native membraneUse of stabilizing detergents (DDM, LMNG)Screen multiple detergents; consider stability assays (TSA, CPM) to identify optimal conditions
Low expression yieldsFusion partners (MBP, SUMO); specialized expression strainsBalance between quantity and quality; assess functional integrity of fusion constructs
Conformational heterogeneityNanobodies or antibody fragments as crystallization chaperonesGenerate and screen multiple stabilizing binding partners
Crystallization difficultiesLipidic cubic phase (LCP) crystallization; detergent screeningSystematic optimization of lipid composition and detergent type
Data collection challengesMicrofocus beamlines; room temperature data collectionPlan for multiple crystals to overcome radiation damage issues
Alternative to crystallographySingle-particle cryo-EM with Volta phase platesConsider preparing the entire fumarate reductase complex for improved particle size

Researchers should consider whether studying isolated frdD or the complete fumarate reductase complex would provide more meaningful structural insights, as the native interactions between subunits are likely critical for understanding frdD's true physiological conformation and function .

How can advanced biophysical techniques enhance our understanding of frdD membrane integration?

Several cutting-edge biophysical methods can provide deeper insights into frdD membrane integration:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can map solvent-accessible regions of frdD, helping identify which portions of the protein are embedded in the membrane versus exposed to the aqueous environment. Time-course experiments can also reveal dynamics of membrane interaction.

  • Solid-state NMR spectroscopy: For membrane proteins like frdD, solid-state NMR can provide atomic-level structural information while the protein remains in a membrane-like environment. This approach can determine the orientation of transmembrane helices and identify residues involved in crucial interactions.

  • Molecular dynamics simulations: Computational approaches can model how frdD integrates into lipid bilayers and interacts with other subunits of the fumarate reductase complex. These simulations can reveal dynamic aspects of protein behavior that are difficult to capture experimentally.

  • Single-molecule force spectroscopy: This technique can measure the energetics of membrane insertion and the stability of frdD within the membrane, providing insights into the biophysical principles governing its anchoring function.

  • Neutron reflectometry: When combined with deuterated lipids, this technique can precisely locate frdD within model membranes, determining insertion depth and orientation with minimal perturbation to the system.

These advanced techniques, while technically demanding, offer complementary information that can significantly enhance our understanding of how frdD performs its essential membrane anchoring role in the fumarate reductase complex .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.