Recombinant Cronobacter sakazakii L-alanine exporter AlaE (alaE)

Shipped with Ice Packs
In Stock

Description

Functional Role in Alanine Homeostasis

AlaE exports excess L-alanine and D-alanine to prevent toxic intracellular accumulation . Key findings:

  • Substrate Specificity: Primarily transports L-alanine but exhibits secondary activity for D-alanine under high intracellular concentrations .

  • Energy Dependency: Functions via proton motive force, distinguishing it from passive diffusion systems .

  • Physiological Impact: Overexpression reduces intracellular alanine levels by 90%, enhancing bacterial survival in peptide-rich environments .

Expression and Purification

ParameterDetails
Host SystemsE. coli, yeast, baculovirus, mammalian cells
Purity≥85% (SDS-PAGE verified)
YieldOptimized for 50 µg to 1 mg scales, depending on expression system

Research Applications

  • Mechanistic Studies: Used in transport assays with radiolabeled alanine to quantify export kinetics .

  • Structural Analysis: Oligomerization studies using cryo-EM to resolve GxxxG motif interactions .

  • Biotechnological Use: Potential chassis for metabolic engineering to overproduce alanine in industrial strains .

Key Research Findings

Study FocusMethodologyKey ResultSource
Export MechanismRadiolabeled d-alanine transport assaysAlaE reduces intracellular d-alanine by 95%
Toxicity MitigationCoculture assays with alanine auxotrophsOverexpression improves survival by 80%
Regulatory RoleTranscriptional analysis under Lrp regulationalaE expression induced by L-alanine

Comparative Analysis of AlaE Orthologs

Recombinant AlaE variants across bacterial species highlight functional conservation:

SpeciesGeneHost SystemActivity
C. sakazakii (ATCC BAA-894)ESA_00597E. coliL/D-alanine export
Yersinia enterocoliticaalaECell-free expressionL-alanine-specific
Dickeya zeaeDd1591_0599Mammalian cellsPartial activity

Challenges and Future Directions

  • Structural Resolution: Full-length crystal structure remains unresolved, limiting mechanistic insights .

  • Industrial Scaling: Low yields in eukaryotic systems necessitate optimization .

  • Pathogenicity Links: Role in C. sakazakii virulence (e.g., infant meningitis) requires further study .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery estimates.
Note: Our proteins are routinely shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Dissolve the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life can be influenced by multiple factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production process. If you have a specific tag type in mind, please inform us, and we will prioritize development according to your specifications.
Synonyms
alaE; ESA_00597; L-alanine exporter AlaE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-158
Protein Length
full length protein
Species
Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)
Target Names
alaE
Target Protein Sequence
MSQELNSMFSPHSRLRHAVADTFAMVVYCSVVGMMIEIFVSGMSFEQSLSSRLVAIPVNM VIAWPYGLYRDAVMRLAARVGKGRLVRNLADVIAYITFQSPVYAAILLFVGADIPQIITA VSSNIVVSMMMGAAYGYFLDYCRRLFRVSPAAPVSAQA
Uniprot No.

Target Background

Function
Exports L-alanine.
Database Links
Protein Families
AlaE exporter family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Cronobacter sakazakii L-alanine exporter AlaE and what is its functional significance?

The L-alanine exporter AlaE (alaE) from Cronobacter sakazakii is a membrane transport protein responsible for exporting L-alanine from the bacterial cytoplasm to the extracellular environment. Based on available data, AlaE is a 158-amino acid protein that plays a role in amino acid homeostasis . The functional significance of AlaE extends beyond simple amino acid transport, as it appears to be integrated into broader regulatory networks including quorum sensing systems.

Recent research has identified AlaE as a downregulated gene in LuxS-deficient bacterial strains, with a fold change of 0.44819015 compared to wild-type strains . This suggests that AlaE expression is positively regulated by the LuxS/AI-2 quorum sensing system, potentially linking L-alanine export to bacterial population density sensing and coordinated behaviors.

What is the protein structure and sequence of Cronobacter sakazakii AlaE?

The full-length Cronobacter sakazakii AlaE protein consists of 158 amino acids with the following sequence:

MSQELNSMFSPHSRLRHAVADTFAMVVYCSVVGMMIEIFVSGMSFEQSLSSRLVAIPVNMVIAWPYGLYRDAVMRLAARVGKGRLVRNLADVIAYITFQSPVYAAILLFVGADIPQIITAVSSNIVVSMMMGAAYGYFLDYCRRLFRVSPAAPVSAQA

Structural predictions suggest that AlaE contains multiple transmembrane domains typical of membrane transporters. The protein sequence contains hydrophobic regions that likely span the membrane, forming a channel or pore for L-alanine transport. While a high-resolution structure has not been reported in the provided search results, computational analyses would predict an alpha-helical structure within the membrane, consistent with other bacterial transporters.

How is recombinant AlaE protein expressed and purified for research purposes?

Based on the search results, recombinant Cronobacter sakazakii AlaE is typically expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification . The standard methodology involves:

  • Cloning the alaE gene (encoding amino acids 1-158) into a suitable expression vector with an N-terminal His-tag

  • Transforming the construct into E. coli expression strains

  • Inducing protein expression under optimized conditions

  • Cell lysis and membrane protein extraction, typically using detergents

  • Immobilized metal affinity chromatography (IMAC) to purify the His-tagged protein

  • Quality control by SDS-PAGE, with >90% purity typically achieved

  • Final preparation as a lyophilized powder for storage

For optimal results, researchers should avoid repeated freeze-thaw cycles and store working aliquots at 4°C for routine use . As AlaE is a membrane protein, special consideration must be given to maintaining its native conformation during purification, potentially requiring specific detergents or lipid environments.

How can researchers investigate the relationship between AlaE and quorum sensing systems?

The connection between AlaE and quorum sensing systems, particularly LuxS/AI-2, presents an interesting research avenue. Transcriptomic analysis has shown that alaE is downregulated in luxS knockout strains , suggesting regulatory connections between these systems. To investigate this relationship, researchers should consider the following methodological approaches:

  • Promoter-Reporter Fusion Assays:

    • Clone the alaE promoter region upstream of a reporter gene (e.g., luciferase, GFP)

    • Measure promoter activity in wild-type vs. ΔluxS strains

    • Test the effect of exogenous AI-2 addition on promoter activity

    • Identify specific promoter elements responsive to quorum sensing regulators

  • Chromatin Immunoprecipitation (ChIP):

    • Use tagged versions of quorum sensing regulators

    • Identify direct binding to the alaE promoter region

    • Map binding sites through sequencing of immunoprecipitated DNA

  • Transport Activity Measurements:

    • Compare L-alanine export rates in wild-type vs. ΔluxS strains

    • Assess the impact of synthetic AI-2 addition on transport activity

    • Measure intracellular and extracellular L-alanine levels using HPLC or LC-MS methods

  • Epistasis Analysis:

    • Generate double mutants (ΔalaE/ΔluxS)

    • Compare phenotypes to single mutants to establish genetic relationships

    • Complement with wild-type genes to confirm specific effects

This research would help establish whether AlaE function is directly regulated by quorum sensing or whether the relationship is part of a broader physiological response network.

What role might AlaE play in biofilm formation and antibiotic resistance?

Research on LuxS/AI-2 quorum sensing systems has demonstrated their involvement in bacterial biofilm formation and antibiotic resistance . Since alaE expression appears to be linked to this system, it may contribute to these phenotypes through several potential mechanisms:

Potential roles in biofilm formation:
Transcriptomic analysis shows that luxS deletion affects biofilm formation regulators like bssS . The regulatory connection between luxS and alaE suggests potential roles for AlaE in biofilm development. To investigate this, researchers should:

  • Compare biofilm formation between wild-type, ΔalaE, and alaE-overexpressing strains

  • Analyze extracellular matrix composition, particularly amino acid content

  • Perform time-course expression analysis of alaE during biofilm development

  • Assess the impact of exogenous L-alanine on biofilm structure and integrity

Connections to antibiotic resistance:
The LuxS/AI-2 system influences antibiotic susceptibility, with luxS deletion increasing sensitivity to aminoglycoside antibiotics . To investigate AlaE's potential role in this phenotype, researchers should:

  • Perform antibiotic susceptibility testing on ΔalaE mutants against multiple antibiotic classes

  • Measure membrane permeability in wild-type vs. ΔalaE strains

  • Assess the impact of L-alanine export on intracellular pH and proton motive force

  • Investigate potential interactions between AlaE and efflux pump systems

Research has shown that regulatory proteins like SdiA enhance expression of efflux pumps (AcrAB, AcrAD, AcrEF) that contribute to resistance against β-lactams, quinolones, tetracyclines, and chloramphenicol . Understanding AlaE's relationship to these regulatory networks could reveal its contribution to resistance phenotypes.

What methodologies are most effective for analyzing AlaE transport kinetics?

Characterizing the transport kinetics of AlaE requires specialized approaches to accurately measure L-alanine export. Based on methodologies used for similar transporters, researchers should consider:

In vivo transport assays:

  • Radiolabeled substrate tracking:

    • Preload cells with 3H-labeled L-alanine

    • Measure efflux rates under various conditions (pH, temperature, competing substrates)

    • Analyze data using suitable kinetic models (Michaelis-Menten, Hill equation)

  • HPLC-based quantification:

    • Collect supernatant samples at timed intervals

    • Quantify L-alanine using HPLC with pre-column derivatization

    • Calculate initial rates at different substrate concentrations

In vitro reconstitution systems:

  • Proteoliposome-based transport assays:

    • Reconstitute purified AlaE into liposomes of defined composition

    • Establish ion gradients to investigate energy coupling mechanisms

    • Measure L-alanine uptake or efflux using filtration techniques

  • Electrophysiological approaches:

    • Incorporate AlaE into planar lipid bilayers or giant unilamellar vesicles

    • Measure currents associated with transport using patch-clamp techniques

    • Determine voltage dependence and ion coupling stoichiometry

Data analysis considerations:

  • Calculate key kinetic parameters:

    • Km (substrate affinity)

    • Vmax (maximum transport rate)

    • Turnover number

    • Potential cooperativity coefficients

  • Investigate substrate specificity by comparing transport rates for:

    • L-alanine vs. D-alanine

    • Other amino acids

    • Alanine analogs

How does AlaE expression integrate with bacterial stress response systems?

While direct evidence linking AlaE to stress responses is limited in the search results, several findings suggest potential connections that warrant investigation:

The transcriptomic data comparing wild-type and ΔluxS strains revealed differential expression of multiple stress-related genes, including those encoding molecular chaperones (dnaK, groL, htpG) and oxidative stress response proteins (ahpC) . Since alaE is regulated within this same network, it may participate in stress adaptation mechanisms.

Methodological approaches to investigate this connection include:

  • Stress exposure experiments:

    • Subject wild-type and ΔalaE strains to various stressors (osmotic, oxidative, acid, heat)

    • Compare survival rates and recovery kinetics

    • Measure alaE expression under different stress conditions

  • Metabolomic analysis:

    • Compare intracellular amino acid pools in stressed vs. unstressed cells

    • Quantify L-alanine flux during stress adaptation

    • Identify metabolic pathways affected by AlaE dysfunction during stress

  • Regulatory network mapping:

    • Identify potential stress-responsive elements in the alaE promoter

    • Determine whether stress response regulators (e.g., RpoS, OxyR) influence alaE expression

    • Assess epistatic relationships between alaE and stress response genes

Understanding how AlaE contributes to stress adaptation could reveal important insights into bacterial physiology and potential antimicrobial targets.

What is the relationship between AlaE and bacterial pathogenicity?

The potential role of AlaE in Cronobacter sakazakii pathogenicity represents an important research question. Several lines of evidence from the search results suggest possible connections:

  • LuxS/AI-2 quorum sensing systems influence pathogenicity in several bacteria, including E. coli

  • LuxS deletion affects the expression of virulence-related genes, including outer membrane proteins (ompX)

  • LuxS mutants show enhanced adhesion to HCT-8 cells and increased IL-6 production

Since alaE expression is regulated by the LuxS system , it may contribute to pathogenicity through several mechanisms. To investigate this, researchers should consider:

Cell culture-based approaches:

  • Compare adhesion and invasion rates of wild-type vs. ΔalaE strains using epithelial cell models

  • Measure cytokine production (particularly IL-6, IL-8, TNF-α) in response to infection

  • Analyze changes in host cell gene expression following exposure to different bacterial strains

Animal model studies:

  • Assess virulence of ΔalaE mutants in appropriate infection models

  • Compare bacterial loads in different tissues

  • Measure inflammatory responses and histopathological changes

Molecular mechanisms investigation:

  • Determine whether AlaE-exported L-alanine functions as a signaling molecule affecting host responses

  • Investigate interactions between AlaE and other virulence factors

  • Assess the impact of alaE deletion on the expression of known virulence genes

The finding that LuxS deletion promoted IL-6 secretion in HCT-8 cells suggests that understanding how AlaE fits into this regulatory network could reveal important aspects of host-pathogen interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.