Recombinant Cronobacter sakazakii Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Cronobacter sakazakii Lipoprotein Signal Peptidase (LspA)

Lipoprotein signal peptidase (LspA) is an essential aspartyl protease (EC 3.4.23.36) responsible for cleaving the signal peptide of bacterial lipoproteins during their maturation. In Cronobacter sakazakii, a Gram-negative opportunistic pathogen, LspA is critical for processing lipoproteins that contribute to virulence, antibiotic resistance, and environmental adaptability . Recombinant LspA refers to the genetically engineered form of this enzyme, produced for structural, functional, and therapeutic studies.

2.1. Enzyme Architecture

  • Catalytic Mechanism: LspA operates via a catalytic dyad (Asp-His) conserved across bacterial species, enabling cleavage of the signal peptide from prolipoproteins .

  • Conformational Dynamics: Molecular dynamics (MD) simulations and electron paramagnetic resonance (EPR) studies reveal that LspA adopts three conformational states:

    • Closed: Occludes the active site from the lipid bilayer, dominant in the apo state .

    • Intermediate: Stabilized by antibiotics like globomycin, inhibiting substrate binding .

    • Open: Permits substrate entry, critical for enzymatic activity .

2.2. Recombinant Protein Design

The recombinant LspA from C. sakazakii strain ATCC BAA-894 (UniProt: A7MIM2) includes residues 1–165 of the full-length protein, expressed in Escherichia coli with a Tris-based buffer system . Key features include:

ParameterDetails
Expression RegionAmino acids 1–165
Molecular Weight~19 kDa (predicted)
Storage Conditions-20°C in 50% glycerol; avoid freeze-thaw cycles
Sequence FeaturesIncludes conserved catalytic residues (Asp23, His147) and β-cradle motifs

3.1. Antibiotic Resistance Studies

LspA is a target for antibiotic development due to its essential role in lipoprotein processing. Key insights include:

  • Globomycin Binding: Stabilizes the intermediate conformation, blocking substrate access to the active site .

  • Resistance Avoidance: Mutations in LspA’s active site would disrupt substrate binding, making resistance evolution unlikely .

3.2. Vaccine Development

Recombinant LspA has been explored as a vaccine candidate:

  • Protective Immunity: Maternal exposure to C. sakazakii recombinant proteins (including LspA) enhanced offspring resistance to bacterial challenges in rat models .

  • Cross-Reactivity: Antibodies against LspA may target conserved epitopes in other Enterobacteriaceae .

3.3. Enzymatic Activity Profiling

  • Substrate Specificity: Prefers lipoproteins with a diacylglyceryl-modified N-terminus .

  • pH Optimum: Functions optimally at pH 6.5–7.5, aligning with bacterial periplasmic conditions .

4.1. Conservation Across Strains

LspA is highly conserved in C. sakazakii lineages, with no significant allelic variation reported in pan-genome analyses . This conservation underscores its critical role in bacterial survival.

4.2. Phylogenetic Significance

  • Horizontal Gene Transfer: No evidence of LspA recombination in C. sakazakii, unlike other virulence genes .

  • Lineage-Specific Adaptations: Despite genomic diversity in C. sakazakii, LspA remains invariant, suggesting strong purifying selection .

Future Directions

  • Structure-Based Drug Design: Exploiting conformational states (open/closed) for inhibitor development .

  • Multispecies Studies: Comparing LspA across Cronobacter spp. to identify broad-spectrum antibiotic targets .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them when placing your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lspA; ESA_03311; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)
Target Names
lspA
Target Protein Sequence
MSKPILSTGLRWLWLVVVVLIVDLGSKALILQHFALGETVSLFPSLNLHYARNYGAAFSF LADKGGWQRWFFAGIAIGICVLLVVMMYRAKASQKLNNIAYALIIGGALGNLFDRLWHGF VVDMIDFYVGDWHFATFNLADTAICIGAALVVLEGFLPSKQKATA
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does lspA compare to other membrane-associated proteins involved in C. sakazakii pathogenicity?

While direct comparative studies between lspA and other C. sakazakii membrane proteins are not extensively documented, research has identified several membrane-associated proteins that contribute to pathogenicity:

ProteinFunctionRole in PathogenicityReference
LspALipoprotein processingLikely maintains membrane integrity
LamBMaltoporinServes as bacteriophage receptor; structural variations impact phage susceptibility
LpxALipid A biosynthesisFirst enzyme in lipopolysaccharide biosynthesis
OmpAOuter membrane proteinCritical for invasion of intestinal epithelial cells and brain microvascular endothelial cells
LabpLpxA binding partnerEnhances lipid A production, affecting virulence

Research has shown that membrane proteins like OmpA play a critical role in C. sakazakii invasion of human intestinal epithelial cells and brain microvascular endothelial cells . The LamB protein has been studied as a bacteriophage receptor, with structural variations affecting phage susceptibility . Based on these findings, lspA likely contributes to pathogenicity through ensuring proper processing of various lipoproteins that maintain membrane integrity and function.

What expression systems are optimal for producing functional recombinant C. sakazakii lspA?

While the search results don't specify expression systems specifically for C. sakazakii lspA, effective methodology can be inferred from similar membrane protein research:

  • Expression vector selection: pET expression systems with T7 promoter are commonly used for recombinant membrane protein expression due to their tight regulation and high expression levels.

  • Host strain considerations:

    • E. coli BL21(DE3) derivatives that are deficient in certain proteases may improve yield

    • C41(DE3) or C43(DE3) strains specifically engineered for membrane protein expression show reduced toxicity

    • Expression in the original host (C. sakazakii) may be considered for proper folding and function

  • Expression conditions:

    • Induction at reduced temperatures (16-25°C) rather than 37°C

    • Lower IPTG concentrations (0.1-0.5 mM)

    • Use of specialized media enriched with phospholipids

  • Fusion tags:

    • N-terminal His-tag for purification

    • Fusion partners like MBP or SUMO that enhance solubility

    • Inclusion of TEV or other protease cleavage sites for tag removal

When designing expression experiments, researchers should conduct small-scale optimization trials varying these parameters to identify optimal conditions for functional lspA expression.

What purification strategies yield high-quality recombinant lspA for structural and functional studies?

A multi-step purification strategy is recommended for obtaining high-purity recombinant lspA:

  • Membrane extraction:

    • Cell disruption by sonication or high-pressure homogenization

    • Separation of membrane fraction by ultracentrifugation (100,000 × g)

    • Solubilization using detergents appropriate for membrane proteins (e.g., n-dodecyl-β-D-maltoside, LDAO, or digitonin)

  • Chromatographic techniques:

    • Immobilized metal affinity chromatography (IMAC) as initial capture step

    • Ion exchange chromatography for intermediate purification

    • Size exclusion chromatography for final polishing and buffer exchange

  • Detergent exchange or reconstitution:

    • Gradual exchange to milder detergents suitable for downstream applications

    • Reconstitution into nanodiscs or liposomes for functional studies

  • Quality assessment:

    • SDS-PAGE and Western blotting for purity and identity confirmation

    • Mass spectrometry for protein validation

    • Circular dichroism for secondary structure assessment

    • Activity assays to confirm functional integrity

This approach, while not directly documented for lspA in the search results, aligns with standard practices for membrane protein purification and can be adapted based on specific properties of lspA.

How can recombinant lspA be used to study C. sakazakii stress response mechanisms?

Studies have demonstrated that C. sakazakii exhibits remarkable resistance to environmental stresses, including desiccation, acid, and oxidative challenges . Recombinant lspA can be utilized to investigate stress response mechanisms through several experimental approaches:

  • Comparative proteomic analysis:

    • Express wild-type vs. mutant lspA in C. sakazakii

    • Subject bacteria to various stressors (acid, heat, desiccation)

    • Perform differential proteomic analysis to identify changes in the lipoprotein profile

  • Lipoprotein maturation assays:

    • Develop in vitro activity assays using recombinant lspA and synthetic prolipoprotein substrates

    • Assess enzymatic activity under different stress conditions (pH, temperature, ionic strength)

    • Correlate activity changes with stress resistance phenotypes

  • Structure-function studies:

    • Generate site-directed mutants of key residues in lspA

    • Assess impact on C. sakazakii survival under various stress conditions

    • Correlate structural changes with functional outcomes

Research has shown that mutations in lipopolysaccharide (LPS) biosynthesis genes in C. sakazakii significantly alter stress resistance profiles . For example, the ΔwaaC mutant showed lower resistance to acidic, alkali, oxidative, and osmotic stresses compared to wild-type, while the ΔlpxM mutant exhibited lower desiccation resistance but higher osmotic resistance . Similar experimental approaches could be applied to study lspA's role in stress response.

What is the potential relationship between lspA and LPS biosynthesis in C. sakazakii?

The relationship between lspA and LPS biosynthesis in C. sakazakii represents an intriguing research direction. While direct evidence is not available in the search results, several connections can be hypothesized and investigated:

  • Membrane organization interplay:

    • Properly processed lipoproteins (dependent on lspA) may be required for correct localization or function of LPS biosynthesis enzymes

    • Co-localization studies using fluorescently tagged lspA and LPS biosynthesis proteins could reveal spatial relationships

  • Regulatory networks:

    • Transcriptomic analysis comparing wild-type and lspA mutants could reveal effects on expression of LPS biosynthesis genes

    • ChIP-seq studies might identify shared regulatory elements between lspA and LPS biosynthesis genes

  • Functional relationships:

    • Construction of lspA conditional mutants and analysis of LPS profiles

    • Comparative lipidomics analysis similar to that performed for LPS mutants

Experimental evidence has shown that changes in LPS structure in C. sakazakii resulted in altered lipid profiles and intensities, which affected bacterial resistance to environmental stresses . For example, compared to the wild-type strain BAA894, LPS mutants (ΔlpxM and ΔwaaC) showed drastic changes in lipid quantity, with many changed lipids being unsaturated. Additionally, eleven lipid classes exhibited significant variation in relative content, particularly in polyunsaturated TGs with double bonds at positions 5, 7, 12, and 14 .

Could lspA processing affect phage receptors like LamB in C. sakazakii, and how would this impact phage therapy approaches?

The potential relationship between lspA processing and phage receptors represents an unexplored but promising research direction. Research has demonstrated that LamB serves as a critical receptor for bacteriophages targeting C. sakazakii :

  • Receptor modification hypothesis:

    • If LamB requires lipoprotein interactions for proper folding or stability, lspA processing could indirectly affect phage binding

    • A single amino acid change (proline at position 284) in C. sakazakii LamB significantly alters phage binding efficiency

    • Experimental approach: Compare phage susceptibility between wild-type and lspA-deficient strains

  • Dual-receptor phage interaction model:

    • Phages like CSP1 require both LamB and LPS for effective infection of C. sakazakii

    • lspA could influence the spatial organization of these receptors in the membrane

    • Experimental approach: Fluorescence colocalization studies of LamB and LPS in presence/absence of functional lspA

  • Phage cocktail efficacy testing:

    • Recent research showed that phage cocktails targeting distinct host receptors can serve as a promising antimicrobial strategy

    • Understanding how lspA affects receptor expression could inform optimized phage cocktail design

    • Experimental approach: Test efficacy of phage cocktails against wild-type vs. lspA mutants

Research has shown that the polyvalent phage CSP1 requires both C. sakazakii LamB (LamB C) and lipopolysaccharide (LPS) core for infection, whereas it can use E. coli LamB (LamB E) as a sole receptor . This suggests complex interactions between membrane components that could be influenced by proper lipoprotein processing.

How does molecular characterization of lspA contribute to our understanding of C. sakazakii taxonomy and strain typing?

Molecular characterization of lspA could provide additional insights for C. sakazakii taxonomy and strain typing, complementing existing approaches:

Current Typing MethodBasisLimitationsPotential lspA Contribution
MLST7 housekeeping genes (atpD, fusA, glnS, gltB, gyrB, infB, ppsA)May not capture virulence differenceslspA sequence variation could correlate with virulence
fusA sequencingSingle locus speciationLimited resolution within specieslspA as additional marker for enhanced discrimination
O-antigen serotypingLPS O-antigen gene clustersNot all strains can be serotypedlspA variation may correlate with O-antigen types
ompA analysisOuter membrane protein sequenceLimited phylogenetic informationCombining with lspA could improve resolution

Research on C. sakazakii has extensively utilized MLST for strain typing, with fusA being particularly useful for speciation of the Cronobacter genus . The MLST approach has identified clonal complexes (CCs) with specific associations to isolation sources and virulence potential .

Experimental approaches to investigate lspA's value in taxonomy could include:

  • Sequence analysis of lspA across diverse C. sakazakii isolates

  • Correlation of lspA sequence variants with existing typing schemes

  • Development of lspA-based PCR assays for rapid strain identification

  • Investigation of lspA expression levels across different strain types

How can recombinant lspA be used to develop novel detection methods for C. sakazakii in food and clinical samples?

Recombinant lspA has potential applications for developing novel detection methods for C. sakazakii:

  • Antibody-based detection systems:

    • Generate specific antibodies against recombinant lspA

    • Develop ELISA-based detection kits for food and clinical samples

    • Create lateral flow immunoassays for rapid point-of-care testing

    • Potential improvement over current chromogenic agar methods that rely on α-glucosidase activity

  • Aptamer development:

    • Screen DNA/RNA aptamer libraries against recombinant lspA

    • Develop aptamer-based biosensors with enhanced specificity

    • Combine with electrochemical detection for sensitive analysis

  • Mass spectrometry identification:

    • Use recombinant lspA as a standard for MALDI-TOF or LC-MS/MS protocols

    • Develop targeted proteomics approaches for C. sakazakii identification

    • Establish signature peptides unique to C. sakazakii lspA

  • PCR enhancement:

    • Design lspA-specific primers for improved PCR detection

    • Develop multiplex PCR systems combining lspA with other markers

    • Create quantitative PCR standards using recombinant protein expression plasmids

Current detection methods for C. sakazakii involve pre-enrichment followed by selective enrichment, with subsequent plating on chromogenic media . These traditional culture-based methods require significant time (multiple days) and expertise. Novel molecular approaches based on lspA could potentially reduce detection time and improve specificity.

What is the potential of lspA as a target for antimicrobial development against C. sakazakii?

lspA represents a promising target for antimicrobial development against C. sakazakii for several reasons:

  • Essential enzymatic function:

    • Signal peptidases are generally essential for bacterial viability

    • Inhibition would likely disrupt multiple cellular processes dependent on proper lipoprotein maturation

  • Structural features for drug design:

    • As a membrane-embedded aspartic protease, lspA has distinct catalytic characteristics

    • The amino acid sequence (provided in search result ) could be used for structural modeling

    • Virtual screening approaches could identify potential inhibitors

  • Experimental validation approaches:

    • Develop enzymatic assays using recombinant lspA and fluorogenic substrates

    • Screen compound libraries for inhibition of enzymatic activity

    • Test promising compounds in growth inhibition assays

    • Validate specificity by comparing effects on C. sakazakii vs. mammalian cells

  • Combination therapy potential:

    • lspA inhibitors could be combined with existing antibiotics for synergistic effects

    • Could potentially overcome existing resistance mechanisms

Research has shown that C. sakazakii possesses multiple antibiotic resistance genes including msbA, emrR, H-NS, emrB, marA, CRP, and PBP3, providing resistance to beta-lactams, tetracycline, macrolides, fluoroquinolones, and cephalosporins . Novel antimicrobial targets like lspA could help address this resistance challenge.

The development of specialized inhibitors targeting lspA could represent a narrower spectrum approach focused on Cronobacter species, potentially reducing disruption to the normal microbiota compared to broad-spectrum antibiotics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.