Recombinant Cronobacter sakazakii Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Definition and Production

Recombinant YidC is a full-length, His-tagged membrane protein (UniProt ID: A7MN02) expressed in E. coli. It spans 550 amino acids and facilitates the insertion and folding of membrane proteins in Cronobacter sakazakii, a pathogen linked to neonatal infections .

Key Substrates and Interactions

SubstrateRole of YidCCitation
M13/Pf3 phage coatMembrane insertion
ATP synthase subunit cFolding and oligomerization
SecGEnhanced biogenesis via YibN interaction

YibN Interaction Enhances YidC Activity

  • Mechanism: YibN, a YidC interactor identified via BioID, stabilizes YidC in C. sakazakii membranes. Co-expression with YibN increases the production of YidC substrates (e.g., SecG) by 2–3 fold .

  • Functional Impact: YibN overexpression stimulates lipid biosynthesis and inner membrane proliferation, suggesting a regulatory role in YidC’s scramblase activity .

Biotechnological Applications

  • Membrane Protein Studies: Recombinant YidC is used to reconstitute proteoliposomes for in vitro insertion assays .

  • Antimicrobial Target: YidC’s essential role in bacterial viability makes it a candidate for antibiotic development .

Challenges and Future Directions

  • Mechanistic Gaps: The exact structural dynamics of substrate translocation through YidC remain unresolved .

  • Therapeutic Potential: Targeting YidC-YibN interactions could disrupt membrane biogenesis in C. sakazakii and related pathogens .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes, and we will fulfill them based on availability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC; ESA_03978; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-550
Protein Length
full length protein
Species
Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)
Target Names
yidC
Target Protein Sequence
MDSQRNLLVIALLFVSFMIWQTWEQDKAPKPQVQQTTQTTTTAAGSAASQGVPASGQGKL ITVKTDVLSLTINTRGGDIEQALLLAYPKELGSSEPFQLLETTPNFVYQAQSGLTGRNGP DNPNNNKGRPLYNTERDTYVLADGQDELVIPMTFTDEAGNAFTKTFALKRGQYAVYVGYD VKNAGTQPLEISSFGQLKQTIDLPSHRDTGSSNFALHTFRGAAYSTPDEKYEKYKFDTIA DDENLNVNAKGGWVAMLQQYFATAWVPASNVTSNFYTADLGHGVAAIGYKSEPVQVQPGQ TAKLASTLWVGPEIQDKMAQVAPHLDLTVDYGWLWFISQPLFKLLKWIHSFLGNWGFSII AITFIVRGVMYPLTKAQYTSMAKMRLLQPKIQAMRERLGDDKQRMSQEMMALYKAEKVNP LGGCFPLLIQMPIFLALYYMLMGSVELRHAPFALWIHDLSAQDPYYILPILMGATMFFIQ KMSPTTVTDPMQQKIMTFMPVIFTVFFLWFPSGLVLYYIVSNLVTILQQQLIYRGLEKRG LHSREKKKKA
Uniprot No.

Target Background

Function
Essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Aids in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Membrane protein insertase YidC and what is its role in Cronobacter sakazakii?

Membrane protein insertase YidC (yidC) in Cronobacter sakazakii is a critical membrane integration protein responsible for facilitating the insertion, folding, and assembly of proteins into the bacterial cell membrane. This protein belongs to the YidC/Oxa1/Alb3 family of membrane protein insertases that are conserved across bacteria, mitochondria, and chloroplasts. In C. sakazakii, YidC plays essential roles in:

YidC is particularly significant in C. sakazakii as this pathogen faces diverse environmental challenges, including desiccation, osmotic stress, and heat stress during food processing and production, where membrane integrity is critical for survival .

How does YidC relate to C. sakazakii pathogenicity and virulence?

While not directly mentioned in the search results as a virulence factor, YidC likely contributes to C. sakazakii pathogenicity through several indirect mechanisms:

  • Membrane integrity maintenance: YidC ensures proper insertion of membrane proteins essential for bacterial survival during infection.

  • Stress response facilitation: By maintaining membrane functionality, YidC enables C. sakazakii to withstand host-induced stresses, including antimicrobial peptides and immune responses.

  • Virulence factor deployment: C. sakazakii possesses virulence factors like OmpA and OmpX (outer membrane proteins) that enable adhesion to and invasion of human cells, including intestinal epithelial cells and brain microvascular endothelial cells . YidC potentially plays a role in the proper assembly of these and other virulence-associated membrane proteins.

  • Antibiotic resistance support: YidC may contribute to the integration of membrane proteins involved in antibiotic resistance mechanisms, as C. sakazakii has been shown to harbor multiple antibiotic resistance genes .

What experimental approaches are most effective for studying recombinant YidC function in C. sakazakii?

To effectively study recombinant C. sakazakii YidC function, researchers should consider several complementary experimental approaches:

In vitro membrane insertion assays:

  • Purified recombinant YidC can be reconstituted into liposomes to study its membrane protein insertion activity

  • Fluorescently labeled substrate proteins can be used to monitor insertion efficiency and kinetics

  • Site-directed mutagenesis of key residues can identify functional domains

Knockout/complementation studies:

  • Generate conditional yidC knockouts in C. sakazakii (as complete deletion may be lethal)

  • Complement with wild-type or mutant versions to assess functional domains

  • Evaluate phenotypic changes including growth rate, stress tolerance, and virulence

Protein-protein interaction studies:

  • Co-immunoprecipitation to identify YidC interaction partners

  • Bacterial two-hybrid systems to map interaction domains

  • Crosslinking experiments to capture transient interactions during membrane insertion

Structural analysis:

  • Cryo-electron microscopy to determine YidC structure in membrane environments

  • X-ray crystallography of soluble domains

  • Molecular dynamics simulations to understand conformational changes during substrate processing

Functional genomics approaches:

  • RNA-seq to determine transcriptional changes in yidC mutants

  • Proteomics to identify membrane proteins dependent on YidC for proper insertion

  • Transposon mutagenesis to identify genetic interactions

How does YidC contribute to C. sakazakii's remarkable environmental stress resistance?

C. sakazakii demonstrates exceptional resistance to environmental stresses, including desiccation, osmotic stress, heat, and acid stress . YidC likely plays a crucial role in this stress resistance through several mechanisms:

Membrane integrity preservation:

  • YidC ensures proper insertion of proteins maintaining membrane barrier function

  • This preserves cellular homeostasis under osmotic stress (C. sakazakii can grow in 10% NaCl)

  • Maintains membrane fluidity adjustments necessary for heat stress adaptation

Stress response protein deployment:

  • Facilitates insertion of membrane-bound stress sensors and signal transducers

  • Enables proper assembly of transporter proteins that mediate ion homeostasis

  • Supports integration of proteins involved in capsule formation and biofilm development

Experimental evidence connection:
C. sakazakii possesses multiple genes associated with desiccation resistance, including capsular polysaccharide genes and colanic acid biosynthesis activation proteins (rcsA, rcsB) . These protective external structures require properly inserted membrane-anchored assembly machinery, likely dependent on YidC function.

The remarkable ability of C. sakazakii to survive in dry conditions (water activity as low as 0.118) correlates with its ability to produce capsules and biofilms . The membrane insertion and assembly of proteins involved in these protective mechanisms likely depend on functional YidC.

What are the structural and functional differences between YidC in C. sakazakii and homologs in other pathogenic bacteria?

While the search results don't provide direct comparative information, analysis of the C. sakazakii YidC sequence suggests several points for comparison with homologs in other bacteria:

Structural comparison:

  • C. sakazakii YidC consists of 550 amino acids, which is similar to the length of YidC in other Enterobacteriaceae

  • The N-terminal region contains a transmembrane domain characteristic of bacterial YidC proteins

  • The periplasmic domain likely contains substrate-binding regions that may differ in sequence between bacterial species

Functional specialization:

  • YidC in C. sakazakii may have evolved specialized functions related to the bacterium's unique ecological niche in dry food environments

  • Specific residues might be optimized for functioning under the distinctive stress conditions faced by C. sakazakii

  • Substrate specificity might differ to accommodate C. sakazakii-specific membrane proteins

Evolutionary considerations:

  • Comparative genomic analysis has identified unique genes in C. sakazakii strains

  • YidC function may be modulated by these strain-specific factors

  • Horizontal gene transfer events may have influenced YidC substrate specificity

A systematic comparison would require:

  • Multiple sequence alignment of YidC proteins from various species

  • Homology modeling to identify structural differences

  • Complementation experiments to test functional equivalence

  • Domain swapping between YidC homologs to identify species-specific functional regions

How can recombinant YidC be used to develop novel antimicrobial strategies against C. sakazakii?

Given the essential role of YidC in membrane protein insertion and C. sakazakii survival, it represents a potential target for novel antimicrobial strategies:

Inhibitor development approaches:

  • High-throughput screening of small molecule libraries to identify YidC inhibitors

  • Rational design of peptides that mimic YidC substrates but block the insertion pathway

  • Development of antibodies or aptamers targeting accessible domains of YidC

Experimental validation strategies:

  • In vitro membrane insertion assays to validate inhibitory effects

  • Growth inhibition studies with potential YidC inhibitors

  • Synergy testing with existing antibiotics

Therapeutic considerations:

  • C. sakazakii has been shown to harbor multiple antibiotic resistance genes (msbA, emrR, H-NS, emrB, marA, CRP, and PBP3)

  • Targeting YidC could provide an alternative strategy against resistant strains

  • YidC inhibitors could potentially disrupt membrane integrity, enhancing the efficacy of existing antibiotics

Model system development:

  • Recombinant YidC could be used in structural studies to identify druggable pockets

  • Cell-based assays monitoring YidC-dependent protein insertion could screen for inhibitors

  • Animal models of C. sakazakii infection could validate the efficacy of YidC inhibitors

What expression systems yield optimal production of functional recombinant C. sakazakii YidC?

Expression system options:

  • E. coli-based systems:

    • BL21(DE3) strains for T7-driven expression

    • C41/C43(DE3) strains specifically designed for membrane protein expression

    • Tunable expression systems (e.g., arabinose-inducible) to control expression levels

  • Alternative bacterial systems:

    • Lactococcus lactis for difficult-to-express membrane proteins

    • Bacillus subtilis for proteins toxic to E. coli

  • Cell-free expression systems:

    • Particularly useful for toxic membrane proteins

    • Allows direct incorporation into provided liposomes

Expression optimization factors:

  • Induction conditions: Low temperature (16-20°C) induction often improves membrane protein folding

  • Media composition: Enhanced with glycerol and specific ion concentrations for membrane protein stability

  • Fusion tags: N-terminal His-tag as used in the referenced product , but MBP or SUMO tags may improve solubility

  • Codon optimization: Adapting codon usage to expression host can improve yields

Validation methods:

  • Western blotting to confirm full-length expression

  • Membrane fractionation to verify membrane integration

  • Functional assays to ensure proper folding and activity

What purification strategies provide the highest quality recombinant YidC for functional studies?

Purification of membrane proteins like YidC presents unique challenges. The following strategies can help obtain high-quality recombinant YidC:

Solubilization approaches:

  • Detergent screening: Test multiple detergents (DDM, LMNG, digitonin) for optimal solubilization

  • Detergent concentration optimization: Use the minimum effective concentration to avoid protein denaturation

  • Buffer optimization: Include stabilizing agents such as glycerol and specific lipids

Purification methods:

  • Immobilized metal affinity chromatography (IMAC):

    • Utilize the His-tag present on the recombinant protein

    • Include detergent in all buffers to maintain solubility

    • Consider on-column detergent exchange if necessary

  • Size exclusion chromatography (SEC):

    • Critical for removing aggregates and ensuring homogeneity

    • Useful for assessing protein quality (monodispersity)

    • Can be combined with detergent exchange to final working detergent

  • Additional purification steps:

    • Ion exchange chromatography for charged contaminant removal

    • Affinity purification with substrate mimics for activity-based purification

Quality assessment metrics:

  • SDS-PAGE for purity assessment (>90% recommended)

  • SEC profile for aggregation state evaluation

  • Dynamic light scattering for homogeneity assessment

  • Activity assays to confirm functional state

Storage considerations:

  • Store in buffer containing detergent above critical micelle concentration

  • Include 6% trehalose or other stabilizers as mentioned in the product description

  • Aliquot and store at -80°C to avoid freeze-thaw cycles

  • Consider flash-freezing in liquid nitrogen to minimize damage

What methodological approaches can be used to characterize YidC-substrate interactions in C. sakazakii?

Understanding YidC-substrate interactions is crucial for elucidating its role in C. sakazakii pathogenicity and stress response. Several methodological approaches can be employed:

Site-directed crosslinking:

  • Introduction of photo-reactive amino acids at strategic positions in YidC

  • UV-induced crosslinking during substrate translocation

  • Mass spectrometry identification of crosslinked residues

Surface plasmon resonance (SPR):

  • Immobilize purified YidC in nanodiscs or detergent

  • Measure binding kinetics with potential substrate proteins

  • Determine affinity constants for different substrates

Förster resonance energy transfer (FRET):

  • Label YidC and substrates with fluorescent donor/acceptor pairs

  • Monitor real-time interaction during membrane insertion process

  • Map interaction domains through strategic placement of fluorophores

Cryo-electron microscopy:

  • Capture YidC-substrate complexes at various stages of insertion

  • Determine structural changes during the insertion process

  • Identify critical interaction interfaces

In vivo approaches:

  • Bacterial two-hybrid screening to identify interacting partners

  • Co-immunoprecipitation followed by proteomics to identify natural substrates

  • Genetic suppressor screening to identify functional interactions

Substrate specificity profiling:

  • Design chimeric reporter substrates with systematic variations

  • Measure insertion efficiency to define substrate requirements

  • Develop prediction algorithms for YidC-dependent proteins in C. sakazakii

This methodological toolkit would enable researchers to systematically characterize how YidC contributes to the insertion of proteins involved in C. sakazakii's virulence and stress resistance mechanisms .

How should researchers interpret conflicting data on YidC function in different C. sakazakii strains?

C. sakazakii strains show significant genomic diversity, with different strains possessing unique genes that may affect YidC function and its physiological context . When confronted with conflicting experimental data, researchers should consider:

Strain-specific genomic contexts:

  • The genomic analysis of C. sakazakii reveals strain-specific unique genes (109 unique genes in C7 strain and 188 in C8 strain)

  • These genomic differences may affect YidC function directly or indirectly

  • Carefully document and compare the specific strains used across studies

Methodological considerations:

  • Expression conditions can significantly affect recombinant protein function

  • Purification methods may differentially preserve activity

  • Assay conditions (pH, salt, temperature) should be standardized

Data integration approaches:

  • Systematically compare YidC function across multiple strains using standardized methods

  • Correlate functional differences with genomic variations using comparative genomics

  • Consider constructing chimeric YidC proteins to identify domains responsible for functional differences

Physiological context variables:

  • YidC function may vary depending on growth phase and environmental conditions

  • Different stress conditions may alter the substrate specificity or activity of YidC

  • Interaction partners may vary between strains and affect YidC function

Experimental design recommendations:

  • Include multiple C. sakazakii strains in comparative studies

  • Test YidC function under various physiologically relevant conditions

  • Use complementation experiments to verify functional equivalence between strains

What statistical approaches are most appropriate for analyzing YidC membrane insertion efficiency data?

When analyzing membrane protein insertion efficiency mediated by YidC, researchers should consider these statistical approaches:

Quantitative analysis methods:

  • Dose-response modeling: Fit insertion efficiency data to Hill equation or similar models

  • Time-course analysis: Use non-linear regression to determine insertion kinetics parameters

  • Comparative analysis: ANOVA with post-hoc tests for comparing insertion efficiency across conditions

Experimental design considerations:

  • Include technical replicates (minimum n=3) and biological replicates (different protein preparations)

  • Incorporate appropriate positive and negative controls in each experiment

  • Include internal standards for normalization across experiments

Data normalization strategies:

  • Normalize to wild-type YidC activity under standard conditions

  • Consider using multiple normalization methods to ensure robustness

  • Account for batch effects through appropriate statistical models

Advanced statistical approaches:

  • Principal component analysis to identify patterns in multivariate insertion data

  • Machine learning approaches to identify features predicting insertion efficiency

  • Bayesian modeling for incorporating prior knowledge about insertion mechanisms

Reporting recommendations:

  • Report both relative and absolute measures of insertion efficiency

  • Include measures of variability (standard deviation, standard error, confidence intervals)

  • Provide raw data alongside processed results for transparency

How can recombinant YidC be utilized in vaccine development against C. sakazakii infections?

While YidC itself is not typically considered a primary vaccine target due to its conservation across bacterial species and potential cross-reactivity, research on recombinant YidC could inform vaccine strategies:

YidC-dependent antigen identification:

  • YidC is responsible for inserting various membrane proteins, some of which could be effective vaccine targets

  • Systematic identification of YidC-dependent outer membrane proteins in C. sakazakii

  • Prioritization of surface-exposed, YidC-dependent proteins unique to C. sakazakii

Subunit vaccine considerations:

  • Recombinant YidC could be used to produce and purify properly folded membrane proteins as vaccine candidates

  • Focus on YidC-dependent proteins involved in virulence, such as adhesins or invasins

  • C. sakazakii proteins OmpA and OmpX, which enable adhesion to and invasion of human cells , could be potential targets

Vaccine efficacy testing:

  • In vitro neutralization assays with antibodies against YidC-dependent antigens

  • Animal models to assess protection against C. sakazakii challenge

  • Immunogenicity studies to evaluate antibody response quality and quantity

Vaccine formulation strategies:

  • Outer membrane vesicles containing YidC-dependent antigens

  • Recombinant protein vaccines with adjuvants

  • DNA vaccines encoding YidC-dependent surface antigens

The ability of C. sakazakii to survive extreme environments makes it challenging to control through conventional means, increasing the importance of effective vaccines for high-risk populations.

What are the practical applications of studying YidC for developing diagnostic tools for C. sakazakii contamination?

Understanding YidC and its substrates could inform the development of novel diagnostic approaches for detecting C. sakazakii contamination in food and clinical samples:

Antibody-based detection systems:

  • Generate antibodies against YidC-dependent surface proteins specific to C. sakazakii

  • Develop lateral flow assays for rapid detection in food production environments

  • Create ELISA-based systems for quantitative contamination assessment

Molecular diagnostic approaches:

  • Design PCR primers targeting C. sakazakii-specific regions of the yidC gene

  • Develop LAMP (Loop-mediated isothermal amplification) assays for field detection

  • Create DNA microarrays including yidC and its substrate genes for strain typing

Functional biomarkers:

  • Identify YidC-dependent proteins involved in biofilm formation

  • Develop assays detecting biofilm components specific to C. sakazakii

  • Create sensors detecting metabolic activities of YidC-dependent proteins

Practical implementation considerations:

  • Sensitivity requirements: C. sakazakii contamination must be detected at very low levels in infant formula and clinical samples

  • Specificity challenges: Distinguish C. sakazakii from closely related species

  • Field applicability: Develop methods suitable for food processing environments

The gene sequences identified in C. sakazakii strains, including unique genes in food isolates , could provide targets for highly specific diagnostic approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.