Recombinant Cronobacter sakazakii NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
nuoA; ESA_00932; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-149
Protein Length
full length protein
Species
Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)
Target Names
nuoA
Target Protein Sequence
MSMSTSTEVIAHHWAFGIFLIVAIGLCCLMLVGAWFLGGRARARYKNTPFESGIDSVGTA RLRLSAKFYLVAMFFVIFDVEALYLFAWSTSVREVGWLGFIEAAIFILVLLAGLVYLVRI GALEWTPSRSRRERLNTEEAGSLTNRHTQ
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, ubiquinone is believed to be the primary electron acceptor. This redox reaction is coupled with proton translocation; for every two electrons transferred, four protons are translocated across the cytoplasmic membrane, thereby conserving redox energy as a proton gradient.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Cronobacter sakazakii NADH-quinone oxidoreductase subunit A (nuoA)?

Cronobacter sakazakii NADH-quinone oxidoreductase subunit A (nuoA) is a protein subunit of the NADH dehydrogenase complex (also known as Complex I) in the respiratory chain of Cronobacter sakazakii. This protein is encoded by the nuoA gene (locus tag ESA_00932) in Cronobacter sakazakii strain ATCC BAA-894 (formerly known as Enterobacter sakazakii). The protein functions as part of the electron transport chain, catalyzing the transfer of electrons from NADH to quinones, contributing to bacterial energy metabolism .

The nuoA protein has the UniProt accession number A7MH22 and functions as an integral membrane protein with an EC number of 1.6.99.5. As part of the NADH dehydrogenase complex, nuoA participates in the first step of the respiratory chain, a process crucial for bacterial survival and growth .

How does Cronobacter sakazakii differ from other foodborne pathogens?

Cronobacter sakazakii stands apart from many other foodborne pathogens due to its remarkable ability to persist in extremely dry environments. This unique survival characteristic allows it to contaminate dehydrated products like powdered infant formula (PIF), protein shakes, powdered milk, herbal teas, and even dry starches such as potatoes and rice .

Unlike many pathogens that struggle in desiccated conditions, C. sakazakii has evolved specific mechanisms to withstand prolonged periods of dryness, making it particularly problematic in food production environments. Additionally, C. sakazakii forms biofilms on food processing surfaces and equipment, which serves as a persistent source of contamination . These biofilms consist of microbial communities attached to surfaces using a self-produced matrix of extracellular polymeric substances that provide protection against environmental stressors and antimicrobial agents .

Another distinguishing feature is C. sakazakii's specific threat to neonates and immunocompromised individuals, causing severe conditions including meningitis, necrotizing enterocolitis, and bacteremia with mortality rates of 40-80% .

How does the nuoA subunit contribute to bacterial energy metabolism and virulence?

The nuoA subunit plays a critical role in the NADH-quinone oxidoreductase complex (Complex I), which is central to bacterial energy metabolism. As part of this complex, nuoA participates in generating the proton motive force necessary for ATP synthesis. The complex oxidizes NADH to NAD+, transfers the electrons to quinones, and couples this electron transfer to proton translocation across the membrane .

While direct research on nuoA's contribution to Cronobacter sakazakii virulence is limited in the provided search results, we can infer its importance from its role in energy metabolism. Efficient energy production is essential for pathogen survival within hosts, especially under stress conditions encountered during infection. Respiratory chain components like nuoA are critical for:

  • Supporting bacterial growth and replication during infection

  • Providing energy for virulence factor production

  • Maintaining cellular homeostasis under host-induced stress

  • Enabling adaptation to changing environments within the host

Research in related pathogens suggests that disruption of the respiratory chain can attenuate virulence, highlighting the potential importance of nuoA in C. sakazakii pathogenicity. Further studies specifically targeting nuoA in C. sakazakii would be valuable to elucidate its direct contributions to virulence.

What experimental approaches are most effective for studying nuoA function?

Researching nuoA function requires a multi-faceted approach combining molecular, biochemical, and physiological techniques:

  • Gene knockout and complementation studies: Creating nuoA deletion mutants and corresponding complemented strains allows researchers to assess the impact of nuoA absence on bacterial physiology, biofilm formation, stress resistance, and virulence. This approach can reveal phenotypic changes attributable specifically to nuoA.

  • Recombinant protein expression and purification: Expressing the recombinant nuoA protein with appropriate tags (determined during the production process) facilitates purification and subsequent functional studies . Given nuoA's hydrophobic nature, specialized expression systems for membrane proteins may be necessary.

  • Enzymatic activity assays: Developing assays to measure the NADH oxidation activity of purified nuoA or membrane preparations containing the protein. These assays typically involve spectrophotometric monitoring of NADH oxidation at 340 nm.

  • Structural biology techniques: Applying X-ray crystallography, cryo-electron microscopy, or nuclear magnetic resonance spectroscopy to determine the three-dimensional structure of nuoA, providing insights into its functional mechanisms.

  • Protein-protein interaction studies: Using techniques such as bacterial two-hybrid systems, co-immunoprecipitation, or crosslinking approaches to identify binding partners of nuoA within the NADH-quinone oxidoreductase complex or other cellular components.

How can recombinant nuoA be used in developing detection methods for Cronobacter sakazakii?

Recombinant nuoA protein offers several potential applications for developing sensitive and specific detection methods for C. sakazakii:

Antibody-Based Detection Systems:
Purified recombinant nuoA can be used to raise specific antibodies that recognize this protein. These antibodies can then be incorporated into various detection formats:

  • ELISA-based detection: Similar to the commercial ELISA kit mentioned in the search results , systems can be developed that use anti-nuoA antibodies to capture and detect C. sakazakii from food samples. A sandwich ELISA approach could provide high sensitivity.

  • Immunomagnetic separation: Anti-nuoA antibodies coupled to magnetic beads could enable concentration and separation of C. sakazakii from complex food matrices.

  • Lateral flow assays: Rapid field-deployable tests using anti-nuoA antibodies could enable point-of-need testing for C. sakazakii contamination.

Nucleic Acid-Based Detection:
The nuoA gene sequence can serve as a target for PCR-based or isothermal amplification detection methods:

  • qPCR assays: Designing primers targeting the nuoA gene for quantitative detection of C. sakazakii.

  • LAMP (Loop-mediated isothermal amplification): Developing isothermal amplification protocols targeting nuoA for rapid field detection without sophisticated equipment.

These detection methods would be particularly valuable for testing powdered infant formula and processing environments, given C. sakazakii's ability to survive in dry conditions and form biofilms on surfaces .

What are the optimal conditions for expression and purification of recombinant nuoA?

Expression System Selection:
Due to the hydrophobic nature of nuoA as a membrane protein, specialized expression systems are recommended:

  • E. coli C41(DE3) or C43(DE3) strains: These modified BL21(DE3) strains are engineered for membrane protein expression and can accommodate the toxicity often associated with overexpressing membrane proteins.

  • Expression vectors: pET series vectors with tunable promoters allow controlled expression levels, which is crucial for membrane proteins that can be toxic when overexpressed.

  • Fusion tags: N-terminal or C-terminal fusion tags like His6, FLAG, or MBP can aid in purification. For nuoA, the tag type should be determined during the production process to ensure proper folding and function .

Optimal Expression Conditions:

  • Temperature: Lower temperatures (16-25°C) often improve membrane protein folding

  • Inducer concentration: Lower IPTG concentrations (0.1-0.5 mM) for gentler induction

  • Media supplementation: Addition of glycerol (0.5-1%) can enhance membrane protein yield

  • Growth phase: Induction at mid-log phase (OD600 of 0.6-0.8)

Purification Strategy:

  • Membrane isolation: Carefully isolate bacterial membranes through ultracentrifugation after cell lysis

  • Detergent selection: Screen detergents (DDM, LDAO, or OG) for optimal solubilization of nuoA from membranes

  • Affinity chromatography: Utilize the fusion tag for initial purification

  • Size exclusion chromatography: Further purify the protein and assess its oligomeric state

  • Buffer optimization: Maintain a Tris-based buffer with 50% glycerol as suggested in the product information

What are the recommendations for storage and handling of recombinant nuoA protein?

Based on the product information in the search results, the following storage and handling recommendations should be followed for recombinant nuoA protein:

  • Storage temperature: Store at -20°C for regular use, and at -20°C or -80°C for extended storage periods .

  • Avoiding freeze-thaw cycles: Repeated freezing and thawing is not recommended as it can lead to protein denaturation and loss of activity.

  • Working aliquots: Prepare small working aliquots and store them at 4°C for up to one week to minimize freeze-thaw cycles .

  • Buffer composition: Maintain the protein in a Tris-based buffer containing 50% glycerol, which has been optimized for this specific protein .

  • Handling precautions: When working with the protein, keep it on ice to minimize degradation, and avoid prolonged exposure to room temperature.

  • Concentration determination: Use standard protein quantification methods like Bradford or BCA assays, with appropriate controls to account for buffer interference.

  • Activity assessment: Regularly check protein activity before use in experiments to ensure functionality has been maintained during storage.

How can researchers evaluate the functional activity of purified recombinant nuoA?

Several approaches can be employed to assess the functional activity of purified recombinant nuoA:

Enzyme Activity Assays:

  • NADH oxidation assay: Monitor the decrease in NADH absorbance at 340 nm in the presence of appropriate quinone acceptors. The reaction mixture typically contains:

ComponentConcentration
Purified nuoA or nuoA-containing membranes10-50 µg/mL
NADH100-200 µM
Ubiquinone-1 or decylubiquinone50-100 µM
Potassium phosphate buffer (pH 7.4)50 mM
MgCl₂5 mM
  • Artificial electron acceptor assays: Utilize electron acceptors like ferricyanide to bypass the native quinone and measure direct electron transfer from NADH.

Structural Integrity Assessment:

  • Circular dichroism (CD) spectroscopy: Evaluate the secondary structure content of purified nuoA to ensure proper folding.

  • Thermal stability assays: Use differential scanning fluorimetry to assess protein stability under various conditions.

  • Limited proteolysis: Perform controlled proteolytic digestion to evaluate the structural integrity of the protein.

Binding Studies:

  • Ligand binding assays: Measure the binding affinity of nuoA for NADH and quinone substrates using techniques like isothermal titration calorimetry or surface plasmon resonance.

  • Inhibitor sensitivity: Evaluate the sensitivity of nuoA activity to known Complex I inhibitors like rotenone or piericidin A.

How can nuoA be utilized in antimicrobial development research?

Recombinant nuoA protein offers several promising avenues for antimicrobial development research against Cronobacter sakazakii:

Target-Based Drug Discovery:
The bacterial respiratory chain, including NADH-quinone oxidoreductase complexes, represents an attractive target for antimicrobial development. Purified recombinant nuoA can be used in:

  • High-throughput screening: Develop assays to screen chemical libraries for compounds that specifically inhibit nuoA function without affecting human respiratory complexes.

  • Structure-based drug design: If the three-dimensional structure of nuoA is determined, it can guide the rational design of inhibitors that disrupt its function.

  • Allosteric inhibitor development: Identify binding sites on nuoA that, when occupied by small molecules, disrupt protein function through conformational changes.

Alternative Antimicrobial Strategies:
Beyond traditional antibiotics, nuoA can support research into novel antimicrobial approaches:

  • Bacteriophage engineering: Similar to the phage-based strategy described in search result , but targeting bacteria expressing nuoA. The knowledge of surface-expressed epitopes derived from nuoA could be utilized to develop bacteriophages with enhanced binding specificity.

  • Immunomodulatory approaches: Recombinant nuoA can be used to study host immune responses to C. sakazakii, potentially leading to immunomodulatory therapies that enhance pathogen clearance.

  • Biofilm disruption strategies: Investigate how inhibition of nuoA affects biofilm formation and persistence, given C. sakazakii's propensity to form biofilms as a survival strategy .

What role does nuoA play in Cronobacter sakazakii's resistance to environmental stresses?

Cronobacter sakazakii is notable for its ability to survive in extremely dry environments and resist various stresses, including desiccation, pH fluctuations, and antimicrobial treatments. While the direct role of nuoA in these resistance mechanisms isn't explicitly detailed in the search results, several hypotheses based on related bacterial systems can be formulated:

Energy Provisioning During Stress:
As a component of the respiratory chain, nuoA likely contributes to:

  • Maintenance of PMF (proton motive force): Critical for stress response systems that rely on energy-dependent processes.

  • ATP generation: Providing the energy currency needed for adaptive responses to environmental stresses.

  • Redox balance: Helping maintain cellular redox homeostasis under stress conditions.

Possible Research Approaches:
To investigate nuoA's role in stress resistance, researchers could:

  • Compare wild-type and nuoA deletion mutants for their ability to survive desiccation, osmotic stress, pH stress, and antimicrobial treatments.

  • Analyze gene expression patterns of nuoA and related respiratory chain components under various stress conditions.

  • Determine if nuoA upregulation correlates with enhanced survival in dry environments like powdered infant formula.

  • Investigate whether nuoA contributes to the bacterium's ability to form stress-resistant biofilms, which represent a major survival strategy for C. sakazakii .

How does nuoA compare between different Cronobacter species and strains?

Comparative analysis of nuoA across Cronobacter species and strains can provide valuable insights into evolutionary relationships, functional conservation, and potential strain-specific adaptations:

Sequence Conservation Analysis:
Researchers should:

  • Perform multiple sequence alignments of nuoA proteins from various Cronobacter isolates.

  • Calculate sequence identity and similarity percentages to quantify conservation levels.

  • Identify conserved domains that likely represent functionally critical regions.

  • Map known mutations or polymorphisms to assess their potential functional impacts.

Table: Predicted Conservation of Key Structural Elements in nuoA

Structural ElementConservation LevelFunctional Implication
Transmembrane domainsHighCritical for membrane integration
NADH binding motifsHighEssential for substrate recognition
Quinone interaction sitesModeratePossible adaptation to different quinone types
Subunit interaction interfacesHighRequired for complex assembly
Proton translocation pathwayHighCentral to energy conservation

Phylogenetic Analysis:
Constructing phylogenetic trees based on nuoA sequences can:

  • Reveal evolutionary relationships between Cronobacter isolates.

  • Identify potential horizontal gene transfer events.

  • Detect selective pressures acting on specific regions of the protein.

  • Correlate sequence variations with habitat adaptations or virulence differences.

This comparative analysis could potentially identify strain-specific variations in nuoA that might correlate with differences in metabolic efficiency, stress resistance, or virulence among Cronobacter isolates.

What are common challenges in working with recombinant nuoA and how can they be addressed?

Researchers working with recombinant nuoA often encounter several technical challenges inherent to membrane proteins:

Expression Challenges:

  • Low expression yields: Membrane proteins like nuoA typically express at lower levels than soluble proteins.

    • Solution: Optimize expression using specialized strains (C41/C43), lower temperatures (16-20°C), and reduced inducer concentrations.

  • Protein misfolding: Improper folding in heterologous systems can lead to inclusion body formation.

    • Solution: Consider fusion partners known to enhance solubility (MBP, SUMO) or co-express with chaperones.

  • Host toxicity: Overexpression of membrane proteins can disrupt host cell membranes.

    • Solution: Use tightly controlled induction systems and optimize expression time.

Purification Challenges:

  • Membrane extraction efficiency: Incomplete solubilization from membranes.

    • Solution: Screen multiple detergents (DDM, LDAO, FC-12) at various concentrations.

  • Detergent interference: Some detergents may interfere with downstream applications.

    • Solution: Select detergents compatible with intended experiments or consider nanodiscs/amphipols for detergent-free systems.

  • Protein aggregation: Tendency to aggregate during concentration steps.

    • Solution: Include stabilizing agents (glycerol, specific lipids) and avoid excessive concentration.

Functional Analysis Challenges:

  • Loss of native lipid environment: Affects protein conformation and function.

    • Solution: Reconstitute into liposomes or nanodiscs with lipid compositions mimicking bacterial membranes.

  • Complex assembly requirements: nuoA functions as part of a multi-subunit complex.

    • Solution: Consider co-expression with interacting partners or develop assays that don't require complete complex assembly.

How can researchers distinguish between effects specific to nuoA and general respiratory chain disruption?

When studying nuoA function and its potential as an antimicrobial target, it's crucial to differentiate between nuoA-specific effects and general respiratory chain disruption:

Experimental Approaches:

  • Genetic complementation studies:

    • Create nuoA deletion mutants

    • Complement with wild-type nuoA or site-directed mutants

    • Compare phenotypes to identify effects specific to nuoA function

  • Chemical genetic approach:

    • Use inhibitors known to target different respiratory chain complexes

    • Compare phenotypic effects with nuoA deletion/inhibition

    • Identify overlapping versus distinctive effects

  • Metabolic flux analysis:

    • Measure changes in metabolic pathways when nuoA is deleted/inhibited

    • Compare with effects of inhibiting other respiratory chain components

    • Identify nuoA-specific metabolic signatures

  • Bacterial fitness assays:

    • Test growth under different carbon sources requiring varied respiratory chain components

    • Identify conditions where nuoA is specifically important

    • Compare with other respiratory chain mutants

Control Experiments:

Control TypePurposeImplementation
Genetic controlsVerify phenotype specificityCompare nuoA mutants with mutations in other respiratory chain components
Biochemical controlsConfirm direct effectsTest effects of nuoA inhibitors on purified protein vs. whole cells
Physiological controlsAssess biological relevanceCompare effects under different growth conditions requiring varied respiratory activities
Complementation controlsValidate causalityEnsure that restoring nuoA function rescues all observed phenotypes

What emerging technologies could enhance nuoA research?

Several cutting-edge technologies are poised to significantly advance research on Cronobacter sakazakii nuoA:

Structural Biology Advancements:

  • Cryo-electron microscopy (Cryo-EM): The revolution in cryo-EM resolution now allows membrane protein structures to be determined without crystallization, potentially enabling the visualization of nuoA within the complete NADH-quinone oxidoreductase complex.

  • Integrative structural biology: Combining multiple techniques (X-ray crystallography, NMR, crosslinking mass spectrometry) to resolve challenging membrane protein structures like nuoA.

  • AlphaFold and related AI structure prediction tools: These could generate increasingly accurate models of nuoA structure, especially when combined with sparse experimental constraints.

Functional Analysis Technologies:

  • Single-molecule techniques: Apply methods like single-molecule FRET to study conformational changes in nuoA during catalysis.

  • Nanoscale respirometry: Develop microfluidic devices to measure respiratory activity in small samples or even single bacterial cells.

  • In-cell NMR: Study nuoA structure and dynamics directly within living bacterial cells.

Genetic and Genomic Approaches:

  • CRISPR-Cas9 genome editing: Generate precise modifications in the nuoA gene to study structure-function relationships.

  • CRISPRi for conditional knockdowns: Create tunable repression of nuoA expression to study dosage effects.

  • Transposon sequencing (Tn-Seq): Identify genetic interactions between nuoA and other genes under various stress conditions.

Systems Biology Approaches:

  • Multi-omics integration: Combine transcriptomics, proteomics, and metabolomics to understand how nuoA activity influences broader cellular processes.

  • Flux balance analysis: Create computational models of C. sakazakii metabolism to predict the systemic effects of nuoA modulation.

  • Host-pathogen interaction models: Develop cellular and animal models to study how nuoA contributes to virulence during infection.

How might nuoA research contribute to broader understanding of bacterial respiratory complexes?

Research on Cronobacter sakazakii nuoA has potential implications that extend beyond this specific pathogen, contributing to our fundamental understanding of bacterial respiratory complexes:

Evolutionary Insights:

  • Study of nuoA sequence conservation across bacterial species could reveal evolutionary pressures on respiratory complexes and identify adaptations to different ecological niches.

  • Comparison of nuoA from C. sakazakii with homologs from other pathogens might highlight pathogen-specific adaptations in respiratory metabolism.

Structure-Function Relationships:

  • Detailed structural studies of nuoA could clarify the role of this subunit in the assembly and function of the complete NADH-quinone oxidoreductase complex.

  • Investigation of how nuoA contributes to proton translocation mechanisms would advance our understanding of energy coupling in bacterial systems.

Antimicrobial Development:

  • Insights from nuoA research could identify novel druggable sites in respiratory complexes across multiple bacterial pathogens.

  • Understanding similarities and differences between bacterial and mammalian respiratory complexes through nuoA research could guide the development of selective antimicrobials with reduced host toxicity.

Stress Adaptation Mechanisms:

  • Studies on how nuoA function responds to environmental stresses in C. sakazakii could reveal general principles of respiratory chain adaptation under adverse conditions.

  • Investigation of regulatory mechanisms controlling nuoA expression might uncover novel stress response pathways relevant to multiple bacterial species.

By pursuing these research directions, scientists studying C. sakazakii nuoA will not only advance our understanding of this specific pathogen but also contribute valuable insights to broader fields including bacterial bioenergetics, membrane protein biology, and antimicrobial development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.