Recombinant Cronobacter sakazakii NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; ESA_00941; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)
Target Names
nuoK
Target Protein Sequence
MIPLQHGLILAAILFVLGLTGLVIRRNLLFMLIGLEIMINAAALAFVVAGSYWGQTDGQI MYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSEMRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be ubiquinone. This process couples the redox reaction with proton translocation (four hydrogen ions translocated across the cytoplasmic membrane for every two electrons transferred), thereby conserving redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Is nuoK part of the core genome of Cronobacter sakazakii?

Based on pan-genome analyses of 237 C. sakazakii genomes, approximately 19.5% of the 17,158 orthologous gene clusters constitute the core genome . The respiratory chain components, including NADH-quinone oxidoreductase complexes, are typically highly conserved due to their essential metabolic functions. Given that functions involved in proton transport are enriched in C. sakazakii strains, it is likely that nuoK belongs to the core genome, though specific confirmation would require targeted genomic analysis comparing this gene across all sequenced strains.

How does nuoK contribute to bacterial survival under different environmental conditions?

The NADH-quinone oxidoreductase complex, including nuoK, plays a critical role in bacterial energy metabolism. C. sakazakii demonstrates remarkable adaptability across diverse environmental conditions, including temperature ranges from 4°C to 50°C . The respiratory complex containing nuoK likely contributes to this adaptability through:

  • Maintenance of proton motive force under stress conditions

  • Energy production adaptability during niche switching (environmental to host)

  • Metabolic flexibility when encountering different carbon sources

This adaptability may partially explain why C. sakazakii can thrive in diverse settings from powdered infant formula to the human host environment.

What expression systems are optimal for producing recombinant C. sakazakii nuoK?

For membrane proteins like nuoK, the expression system selection is critical:

Expression SystemAdvantagesLimitationsBest For
E. coliHigh yield, cost-effective, rapid growthPotential misfolding of membrane proteinsInitial screening, mutagenesis studies
Bacillus subtilisNatural Gram-positive secretion, reduced inclusion bodiesLower yields than E. coliStructural studies requiring proper folding
Cell-free systemsAvoids toxicity issues, direct access to reactionExpensive, limited scalabilityDifficult-to-express proteins, rapid screening
Yeast (P. pastoris)Post-translational modifications, proper foldingLonger expression timeStudies requiring eukaryotic-like processing

Based on similar membrane protein studies and approaches used for H. pylori nuoK , an E. coli-based expression system with an N-terminal His-tag appears to be a practical starting point, with codon optimization for C. sakazakii sequences.

How can the structural integrity of recombinant nuoK be assessed?

Membrane proteins like nuoK require specific approaches to verify structural integrity:

  • Circular dichroism (CD) spectroscopy to assess secondary structure composition

  • Limited proteolysis to evaluate proper folding

  • Thermal shift assays to determine stability

  • Functional reconstitution in liposomes followed by activity assays (measuring NADH oxidation)

  • Size-exclusion chromatography with multi-angle light scattering (SEC-MALS) to verify oligomeric state

When interpreting results, researchers should consider that recombinant nuoK may behave differently compared to the native protein complex due to the absence of other respiratory complex subunits.

How has recombination influenced the evolution of nuoK in C. sakazakii?

Recombination has significantly shaped the C. sakazakii genome, with approximately 53.3% of the genome showing evidence of recombination history . For metabolic genes like nuoK, several patterns have been observed:

  • The mean fragment size of recombination events in C. sakazakii is 815.559 bp (s.d. = 80.203)

  • The relative rate of recombination to mutation (γ/μ) is estimated at 1.6054 (s.d. = 0.04224)

  • Genes associated with metabolic functions are among the most frequently recombined

To specifically analyze nuoK evolution, researchers should:

  • Perform phylogenetic analysis of nuoK sequences across Cronobacter species

  • Calculate dN/dS ratios to identify selection pressures

  • Apply recombination detection algorithms (e.g., PHI test, which detected significant recombination in C. sakazakii core genome, p-value = 0.0)

  • Use correlation profiles to identify recombination-derived sequence blocks

Experimental designs examining nuoK should account for potential evolutionary mosaicism resulting from this recombination history.

What bioinformatic approaches are most effective for analyzing nuoK sequence variation across clinical isolates?

For comprehensive analysis of nuoK variation across C. sakazakii isolates, the following bioinformatic pipeline is recommended:

  • Sequence Acquisition: Extract nuoK sequences from the 386+ whole genome sequences available

  • Multiple Sequence Alignment: Implement MAFFT alignment as performed in phylogenetic analyses of Cronobacter

  • Diversity Analysis:

    • Calculate nucleotide diversity (π)

    • Identify single nucleotide polymorphisms (SNPs)

    • Detect insertion/deletion events

  • Structural Mapping: Map variants to predicted structural models

  • Recombination Detection: Apply methods such as:

    • PHI test to detect statistical evidence of recombination

    • NeighborNet visualization to identify reticulations in phylogenies

    • Correlation profile analysis to detect recombination-derived sequence blocks

  • Comparative Analysis: Compare nuoK diversity patterns with other respiratory chain components

Based on the observed C. sakazakii genomic diversity patterns, researchers should anticipate significant sequence variation across isolates from different ecological niches (clinical vs. environmental) .

What techniques can be used to study the function of nuoK in C. sakazakii?

The functional characterization of nuoK requires multiple complementary approaches:

TechniqueApplicationMethodological Considerations
Gene knockoutEssential gene testing, phenotypic analysisMay be lethal if nuoK is essential; conditional knockouts may be required
Site-directed mutagenesisStructure-function relationship studiesTarget conserved residues in transmembrane domains
Complementation assaysFunctional validationExpress wild-type nuoK in knockout strains
Membrane potential assaysMeasure impact on proton translocationUse fluorescent dyes (e.g., DiSC3(5))
Bacterial two-hybrid assaysIdentify protein-protein interactionsMap interactions with other complex I subunits
Growth rate measurementsPhenotypic impact of nuoK variantsTest under various conditions (4-50°C) as performed for C. sakazakii strains
Oxygen consumption assaysRespiratory chain activityCompare wild-type and mutant strains

When analyzing results, researchers should consider the growth characteristics of C. sakazakii, which include mean generation times that vary by temperature and media composition, with C. sakazakii showing shorter generation times in powdered infant formula compared to tryptone soya broth .

How can protein-protein interactions of nuoK be studied in the context of the respiratory complex?

To map the interaction network of nuoK within the respiratory complex:

  • Cross-linking Mass Spectrometry (XL-MS):

    • Apply membrane-permeable cross-linkers to intact C. sakazakii cells

    • Isolate the respiratory complex

    • Perform tryptic digestion and analyze cross-linked peptides by LC-MS/MS

    • Map interaction sites between nuoK and partner proteins

  • Co-purification Studies:

    • Express tagged nuoK in C. sakazakii

    • Perform membrane solubilization using mild detergents

    • Isolate protein complexes via affinity chromatography

    • Identify interacting partners by mass spectrometry

  • Cryo-EM Analysis:

    • Purify intact respiratory complex containing nuoK

    • Determine structure by cryo-electron microscopy

    • Localize nuoK within the complex architecture

  • Complementary in silico Approaches:

    • Homology modeling based on related bacterial respiratory complexes

    • Molecular dynamics simulations to predict stable interaction interfaces

    • Coevolution analysis to identify co-evolving residues

These studies should be interpreted in light of C. sakazakii's genomic plasticity and frequent recombination, which may influence protein-protein interaction networks between strains .

How does nuoK contribute to the pathogenicity of C. sakazakii?

While the direct contribution of nuoK to C. sakazakii pathogenicity remains to be fully characterized, respiratory chain components may enhance pathogenicity through:

  • Energy Production for Virulence Factor Expression: Supporting the energetic requirements for producing virulence factors (including those associated with chemotaxis, enterobactin synthesis, type VI secretion system)

  • Adaptation to Host Environment: Enabling metabolic flexibility within the host, particularly through proton transport mechanisms that were found to be enriched in human-derived strains

  • Stress Response: Supporting survival under stress conditions within the host

  • Biofilm Formation: Providing energy for biofilm development, which enhances resistance to antimicrobials and host defenses

Research approaches to investigate these connections should include:

  • Comparative transcriptomics of nuoK expression during infection vs. environmental conditions

  • Testing of nuoK mutants in cellular infection models

  • Analysis of nuoK sequence variations between clinical and environmental isolates

Can structural insights from recombinant nuoK studies inform antimicrobial development?

The respiratory chain represents a potential antimicrobial target, and structural studies of nuoK could inform drug development:

  • Target Validation Approach:

    • Express and purify recombinant nuoK for structural studies

    • Determine high-resolution structure using X-ray crystallography or cryo-EM

    • Identify potential binding pockets unique to bacterial nuoK

    • Screen compound libraries against purified nuoK

  • Key Methodological Considerations:

    • Membrane proteins like nuoK require specialized approaches for structural determination

    • Detergent selection is critical for maintaining native-like structure

    • Crystal contacts are challenging to form with transmembrane regions

    • Nanodiscs or amphipols may provide more native-like membrane environments

  • Specificity Determination:

    • Compare C. sakazakii nuoK structure with human mitochondrial complex I components

    • Identify bacterial-specific features for selective targeting

    • Consider resistance development potential based on the observed recombination frequency in C. sakazakii

Given that C. sakazakii carries various antibiotic resistance genes, including fosfomycin resistance (fos) and multidrug efflux transporter mdf(A) , novel antimicrobial targets like nuoK may offer alternative therapeutic approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.