Recombinant Cronobacter sakazakii p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your preparation.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
aaeA; ESA_03629; p-hydroxybenzoic acid efflux pump subunit AaeA; pHBA efflux pump protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)
Target Names
aaeA
Target Protein Sequence
MKLLTTKITRTAITVVLVVLAFIAIFRAWSFYTESPWTRDARFSADVVAIAPDVAGLITS VDVHDNQLVKKDQVLFTIDQPRYQKALEEAEADVAYYQALANEKRREAGRRNQLGVQAMS REEIDQANNVLQTVLHQLAKAEATRDLAKLDLQRTVIRAPADGWVTNLNVYTGEFITRGS TAVALVKQNSFYVQAYMEETKLEGVRPGFRVEITPLGSNNVLHGTVDSVSAGVTNASSTR DAKGMATVDSNLEWVRLAQRVPVRIRLDKQPGNLYPAGTTATVVVTGERDRDRSQESAFN KLMHRLREFG
Uniprot No.

Target Background

Function
Forms an efflux pump in conjunction with AaeB.
Database Links
Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the AaeA protein and what is its function in Cronobacter sakazakii?

The AaeA protein in Cronobacter sakazakii functions as a subunit of the p-hydroxybenzoic acid (pHBA) efflux pump system. It belongs to the membrane fusion protein family and works in conjunction with the AaeB subunit to form a complete efflux pump system. The AaeA-AaeB system plays a crucial role in exporting aromatic carboxylic acids, particularly p-hydroxybenzoic acid, from bacterial cells. This system appears to serve as a "metabolic relief valve" that helps alleviate toxic effects resulting from imbalanced metabolism .

The protein was originally designated as yhcQ before being renamed to AaeA to reflect its role in aromatic carboxylic acid efflux. The complete efflux system includes several components: AaeA (membrane fusion protein), AaeB (the actual efflux protein), AaeX (a small protein of unknown function), and AaeR (a regulatory protein of the LysR family) .

How is recombinant AaeA protein typically produced and purified for research applications?

For research applications, recombinant Cronobacter sakazakii AaeA protein is typically produced using E. coli expression systems. The full-length gene encoding AaeA (aaeA) is cloned into an expression vector with an N-terminal His-tag to facilitate purification. After expression in E. coli, the protein is purified using affinity chromatography targeting the His-tag .

The purified protein is generally supplied as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE. For reconstitution, the protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To maintain stability during storage, it is recommended to add glycerol to a final concentration of 5-50% and aliquot for long-term storage at -20°C or -80°C. Repeated freeze-thaw cycles should be avoided to prevent protein degradation .

What are the optimal storage and handling conditions for recombinant AaeA protein?

Proper storage and handling of recombinant AaeA protein is critical for maintaining its structural integrity and functional activity. The lyophilized protein should be stored at -20°C or -80°C upon receipt. Before opening, the vial should be briefly centrifuged to bring the contents to the bottom .

For reconstitution, use deionized sterile water to prepare a solution with a concentration of 0.1-1.0 mg/mL. After reconstitution, the protein solution should be supplemented with glycerol (5-50% final concentration) and divided into working aliquots to minimize freeze-thaw cycles. Working aliquots can be stored at 4°C for up to one week, while long-term storage requires -20°C or -80°C temperatures .

The protein is typically supplied in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain stability during lyophilization and reconstitution. When designing experiments, consider that buffer components may affect certain assays and may need to be accounted for in experimental controls .

How can researchers verify the activity of recombinant AaeA protein in experimental setups?

To verify the activity of recombinant AaeA protein, researchers can employ several complementary approaches:

  • Functional Reconstitution Assays: AaeA functions as part of the AaeAB efflux system. Its activity can be assessed by reconstituting the complete efflux system in proteoliposomes or in AaeA/AaeB-deficient bacterial strains, followed by measuring the efflux of p-hydroxybenzoic acid or other known substrates.

  • Hypersensitivity Complementation: As demonstrated in E. coli studies, a functional AaeA protein, when expressed together with AaeB, should suppress the hypersensitivity to p-hydroxybenzoic acid observed in AaeA-deficient strains. This complementation assay provides a direct test of protein functionality .

  • Binding Assays: Since AaeA is part of a membrane fusion protein family, its interaction with AaeB can be assessed using pull-down assays, co-immunoprecipitation, or surface plasmon resonance techniques with the purified proteins.

  • Structural Integrity Verification: Circular dichroism spectroscopy or thermal shift assays can be used to confirm that the recombinant protein is properly folded and stable under experimental conditions.

For all activity assays, it's essential to include appropriate positive and negative controls, such as a known active preparation of the protein and a denatured protein sample, respectively.

What experimental models are suitable for studying AaeA function in the context of bacterial antimicrobial resistance?

Several experimental models are appropriate for investigating the role of AaeA in bacterial antimicrobial resistance:

  • Gene Knockout/Complementation Systems: Creating aaeA deletion mutants in Cronobacter sakazakii or related bacteria, followed by complementation with wild-type or mutated versions of the gene, allows for direct assessment of AaeA's contribution to antimicrobial resistance. This approach revealed that expression of aaeA (yhcQ) and aaeB (yhcP) was necessary and sufficient for suppression of p-hydroxybenzoic acid hypersensitivity in E. coli .

  • Heterologous Expression Systems: Expressing the aaeA gene in model organisms like E. coli strains that lack endogenous efflux systems can help isolate and characterize its specific contributions to resistance.

  • Cell Culture Infection Models: Human cell lines such as differentiated CRL-2263 cells can be infected with wild-type or aaeA-deficient C. sakazakii strains to study the role of AaeA in pathogenesis and antibiotic susceptibility in a host-pathogen context .

  • Antibiotic Susceptibility Testing: Minimum inhibitory concentration (MIC) assays comparing wild-type strains with aaeA mutants can quantify the contribution of AaeA to resistance against specific antibiotics or toxic compounds.

  • Gene Expression Analysis: Quantitative PCR or RNA-seq can be used to monitor changes in aaeA expression in response to various antibiotics or environmental stressors, providing insights into the regulatory mechanisms governing the efflux system.

When designing these experiments, it's important to consider that multiple efflux pumps often function redundantly in bacteria. For instance, C. sakazakii also contains other efflux systems like the AcrA-AcrB fusion protein, which acts as a multidrug efflux transporter with broad substrate specificity .

What is known about the evolutionary history of the AaeA protein in Cronobacter sakazakii, and how does recombination affect its genetic diversity?

The evolutionary history of AaeA in Cronobacter sakazakii is shaped by both vertical inheritance and horizontal gene transfer through recombination. Comprehensive analysis of the C. sakazakii pan-genome reveals significant recombination impact on its genetic diversity and evolution.

Studies using the pairwise homoplasy index (PHI) statistic have detected evidence for significant recombination in the Cronobacter core genome (p-value = 0.0). Visualization of this recombination using SplitsTree4 shows reticulations in phylogenies, indicating non-vertical inheritance .

Quantitative analysis of recombination parameters in C. sakazakii has revealed:

  • Mean fragment size of a recombination event: 815.559 bp (s.d. = 80.203)

  • Recombination coverage: 0.53346 (s.d. = 0.00529), indicating that 53.3% of the genome has experienced recombination

  • Relative rate of recombination to mutation (γ/μ): 1.6054 (s.d. = 0.04224)

These values are comparable to those observed in Acinetobacter baumannii, another pathogen in Gammaproteobacteria with mean fragment size of 860 bp, recombination coverage of 0.40, and γ/μ of 1.3 .

While the search results don't specifically mention recombination in the aaeA gene, the extensive recombination detected across the C. sakazakii genome suggests that efflux pump genes, including aaeA, may have been subject to recombination events that contribute to their diversity across different strains and possibly their functional adaptation.

How does the substrate specificity of the AaeAB efflux system compare to other efflux pumps in Cronobacter sakazakii, and what are the implications for antimicrobial resistance?

The AaeAB efflux system in Cronobacter sakazakii demonstrates a relatively narrow substrate specificity compared to other efflux pumps found in this bacterium:

AaeAB Efflux System:

  • Primarily exports aromatic carboxylic acids, particularly p-hydroxybenzoic acid (pHBA)

  • Only a few aromatic carboxylic acids out of hundreds of diverse compounds tested were defined as substrates

  • Functions as a "metabolic relief valve" to alleviate toxic effects of imbalanced metabolism

Other Efflux Systems in C. sakazakii:

  • Mdf(A): A multidrug efflux transporter with broad substrate specificity, found in nearly all C. sakazakii genomes

  • AcrA-AcrB: Functions as a multidrug efflux transporter with an unusually broad pattern of drug specificities

The substrate specificity differences have important implications for antimicrobial resistance:

  • Layered Defense Strategy: The presence of multiple efflux systems with different substrate specificities provides C. sakazakii with a layered defense against various antimicrobial compounds.

  • Specialized vs. Broad-Spectrum Resistance: While systems like AcrA-AcrB and Mdf(A) confer resistance to a wide range of antibiotics, the AaeAB system appears more specialized for handling specific metabolic byproducts or environmental toxins.

  • Physiological Role vs. Antibiotic Resistance: The primary function of AaeAB may be physiological (handling metabolic imbalances) rather than antibiotic resistance, unlike some of the other efflux systems.

  • Target Selection for Inhibitor Development: The narrow substrate specificity of AaeAB makes it a potentially more specific target for inhibitor development, with possibly fewer off-target effects than inhibitors targeting broad-spectrum efflux pumps.

The prevalence of multiple efflux systems in C. sakazakii, including AaeAB, contributes to its remarkable adaptability within and outside the human host .

What are the current methodologies for structure-function analysis of the AaeA protein, and how might these inform drug development targeting efflux pumps?

Current methodologies for structure-function analysis of membrane fusion proteins like AaeA include:

  • X-ray Crystallography and Cryo-EM: These techniques can resolve the three-dimensional structure of AaeA alone or in complex with AaeB, revealing key interaction sites and conformational changes during substrate transport.

  • Site-Directed Mutagenesis: Systematic alteration of specific amino acid residues can identify critical regions for protein-protein interactions, substrate recognition, or channel formation.

  • Molecular Dynamics Simulations: Computational approaches can model how AaeA interacts with membranes, partner proteins, and substrates, providing insights into the dynamic aspects of efflux pump function.

  • Cross-linking Studies: Chemical cross-linking combined with mass spectrometry can map interaction interfaces between AaeA and other components of the efflux system.

  • Functional Assays with Chimeric Proteins: Creating chimeric proteins by swapping domains between AaeA and related membrane fusion proteins can help define the regions responsible for substrate specificity.

These methodologies can inform drug development targeting efflux pumps in several ways:

Structure-Based Drug Design:

  • Identification of potential binding pockets at critical interfaces between AaeA and AaeB

  • Design of molecules that can disrupt the assembly of the complete efflux complex

  • Development of competitive inhibitors that mimic natural substrates but block transport

Targeting Regulatory Mechanisms:

  • Understanding how gene expression of aaeA is regulated by AaeR could lead to strategies that prevent upregulation of the efflux system

  • Compounds that interfere with the induction of aaeA expression by aromatic carboxylic acids could potentially reduce efflux capacity

Combination Therapy Approaches:

  • Knowledge of the substrate specificity and mechanism of AaeAB could inform rational combination therapies that pair antibiotics with efflux pump inhibitors

  • Understanding the relative contributions of different efflux systems (AaeAB vs. AcrAB vs. Mdf(A)) could help prioritize which pumps to target for maximum efficacy

How can the recombinant AaeA protein be utilized in screening assays for potential efflux pump inhibitors?

Recombinant AaeA protein can be employed in various screening approaches to identify potential efflux pump inhibitors:

  • Binding Assays: Using techniques such as surface plasmon resonance (SPR), microscale thermophoresis (MST), or fluorescence polarization to screen compound libraries for molecules that directly bind to AaeA and potentially interfere with its function.

  • Reconstituted System Assays: Incorporating purified AaeA and AaeB proteins into liposomes or nanodiscs to create a functional efflux system in vitro. Candidate inhibitors can then be tested for their ability to block the transport of fluorescent substrates such as labeled p-hydroxybenzoic acid.

  • Structural Disruption Assays: Thermal shift assays or circular dichroism spectroscopy can identify compounds that destabilize the AaeA protein structure or alter its conformation, potentially inhibiting its function.

  • Protein-Protein Interaction Inhibition: Since AaeA must interact with AaeB to form a functional efflux system, assays that detect disruption of this interaction (e.g., FRET-based assays or split luciferase complementation) can identify compounds that prevent efflux pump assembly.

  • Cell-Based Secondary Screening: Compounds identified in primary screens using purified proteins should be validated in bacterial systems where AaeAB is the predominant efflux mechanism for a specific substrate. An engineered strain expressing only the AaeAB system would provide the clearest results.

When designing these screening assays, it's important to include appropriate controls to distinguish between specific inhibitors of AaeA and compounds that have general membrane-disruptive effects or broadly affect protein stability.

What role does the AaeA protein play in Cronobacter sakazakii virulence and host-pathogen interactions?

  • Survival in Host Environments: By exporting toxic aromatic compounds, the AaeAB efflux system likely contributes to C. sakazakii's ability to survive in hostile host environments where it may encounter antimicrobial compounds produced by the host or competing microorganisms.

  • Potential Role in Infection Models: Cell culture infection models using differentiated CRL-2263 cells infected with C. sakazakii have been established, which could be used to compare wildtype and aaeA-deficient strains to assess the role of AaeA in invasion and intracellular survival .

  • Connection to Known Virulence Mechanisms: C. sakazakii possesses various virulence factors, including chemotaxis proteins, enterobactin synthesis, type VI secretion system, and outer membrane proteins that facilitate attachment to and invasion of intestinal cells . While AaeA is not directly mentioned among these factors, efflux pumps often indirectly support virulence by enhancing bacterial survival under stress conditions.

  • Potential Contribution to Persistence: The "metabolic relief valve" function attributed to the AaeAB system may help C. sakazakii persist in various environments, including dried food products and powdered infant formula, which are common sources of Cronobacter infections .

To definitively establish the role of AaeA in virulence, targeted studies comparing wildtype and aaeA-deficient C. sakazakii strains in relevant infection models would be necessary, along with transcriptomic analysis to determine if aaeA expression changes during host infection.

How does the regulatory network controlling AaeA expression respond to different environmental stressors, and what are the implications for bacterial adaptation?

The regulatory network controlling AaeA expression involves several components and responds to specific environmental signals:

  • AaeR Regulation: Expression of aaeA is regulated by AaeR, a protein of the LysR family encoded by a divergently transcribed gene. This regulator responds to the presence of aromatic carboxylic acids, particularly p-hydroxybenzoic acid (pHBA) .

  • Induction by Aromatic Compounds: Several aromatic carboxylic acid compounds serve as inducers of aaeA expression. When E. coli (and presumably C. sakazakii) is treated with pHBA, there is upregulation of the aaeA gene .

  • Coordinate Expression: The aaeA gene is expressed along with aaeX and aaeB, suggesting a coordinated response to specific stressors that require efflux of aromatic compounds .

The implications for bacterial adaptation include:

Table 1: Environmental Stressors and Adaptive Responses Involving AaeA

Environmental StressorRegulatory ResponseAdaptive Advantage
Presence of p-hydroxybenzoic acidAaeR-mediated upregulation of aaeABEfflux of toxic compound, preventing cellular damage
Metabolic imbalance producing aromatic byproductsIncreased expression of aaeAB efflux systemFunctions as a "metabolic relief valve" to maintain homeostasis
Exposure to certain aromatic antibioticsPotential induction of aaeAB expressionContribution to intrinsic antibiotic resistance
Competitive microbial environmentsExpression of efflux systems including AaeABEnhanced survival in presence of microbial warfare compounds

The specialized nature of the AaeAB system, focusing on aromatic carboxylic acids rather than a broad range of compounds, suggests it evolved to address specific ecological challenges. This targeted response might represent a more energy-efficient strategy compared to broad-spectrum efflux systems, allowing C. sakazakii to fine-tune its response to particular environmental conditions .

What are the current challenges and limitations in producing high-quality recombinant AaeA protein for structural and functional studies?

Producing high-quality recombinant membrane-associated proteins like AaeA presents several challenges:

  • Membrane Association: As a membrane fusion protein, AaeA likely contains hydrophobic regions that can cause aggregation or misfolding when expressed recombinantly. Researchers must optimize expression conditions to maintain proper folding.

  • Expression Systems: While E. coli is commonly used for expressing recombinant AaeA , it may not provide the optimal cellular environment for proper folding and post-translational modifications. Alternative expression systems such as Pichia pastoris or insect cells might be considered for problematic constructs.

  • Protein Solubility: Maintaining the solubility of membrane-associated proteins during purification often requires careful selection of detergents or amphipols. The choice of solubilizing agent can significantly impact protein activity and stability.

  • Protein Stability: The current recommendation of storing AaeA with glycerol and avoiding freeze-thaw cycles indicates potential stability issues . Developing improved buffer formulations or stabilizing additives would benefit long-term studies.

  • Functional Reconstitution: For functional studies, AaeA needs to be reconstituted with its partner protein AaeB in a membrane-like environment. Establishing reliable reconstitution protocols that maintain native-like activity is challenging but essential.

To address these challenges, researchers are continuously developing improved methods, such as:

  • Membrane mimetic systems (nanodiscs, liposomes, amphipols)

  • Fusion tags that enhance solubility (MBP, SUMO)

  • Cell-free expression systems that allow direct incorporation into artificial membranes

  • Cryo-electron microscopy techniques that require less protein and can work with smaller, membrane-embedded complexes

How can advanced molecular techniques be applied to study the interaction between AaeA and AaeB in the context of the complete efflux system?

Several advanced molecular techniques can elucidate the interaction between AaeA and AaeB and characterize the complete efflux system:

  • Cryo-Electron Microscopy (Cryo-EM): This technique can reveal the three-dimensional structure of the entire AaeAB complex embedded in a membrane environment, providing insights into how these proteins assemble to form a functional efflux channel.

  • Single-Molecule Förster Resonance Energy Transfer (smFRET): By labeling specific sites on AaeA and AaeB with fluorescent dyes, researchers can monitor real-time conformational changes during substrate binding and transport, revealing the dynamic aspects of efflux pump function.

  • Native Mass Spectrometry: This technique can determine the stoichiometry and stability of the AaeAB complex and identify additional interacting proteins in the native cellular context.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): HDX-MS can map the interaction interfaces between AaeA and AaeB by identifying regions protected from deuterium exchange when the proteins form a complex.

  • In-Cell NMR Spectroscopy: This emerging technique allows for the study of protein structures and interactions within living cells, providing insights into how the AaeAB system functions in its native environment.

  • Genetic Code Expansion and Photo-Crosslinking: Incorporating unnatural amino acids with photo-crosslinking properties at specific positions in AaeA can trap transient interactions with AaeB during the transport cycle.

  • Integrative Structural Biology Approaches: Combining multiple techniques (X-ray crystallography, Cryo-EM, molecular dynamics simulations, cross-linking mass spectrometry) can provide a more complete picture of the AaeAB system's structure and function than any single method.

These techniques, when combined with functional assays measuring efflux activity, can establish structure-function relationships critical for understanding the molecular mechanism of the AaeAB efflux system.

What are the most effective experimental designs for investigating the role of AaeA in antimicrobial resistance and developing targeted inhibitors?

To effectively investigate AaeA's role in antimicrobial resistance and develop targeted inhibitors, researchers should consider the following experimental designs:

For Establishing AaeA's Role in Antimicrobial Resistance:

  • Gene Deletion and Complementation Studies:

    • Generate precise aaeA knockout strains in C. sakazakii

    • Complement with wild-type and mutant versions of aaeA

    • Perform comprehensive antibiotic susceptibility testing comparing wild-type, knockout, and complemented strains

    • Measure growth kinetics under various stress conditions to determine phenotypic consequences of aaeA deletion

  • Expression Analysis:

    • Use RNA-seq or qRT-PCR to monitor aaeA expression in response to various antibiotics and environmental stressors

    • Correlate expression levels with antibiotic resistance phenotypes

    • Map the regulatory network controlling aaeA expression through ChIP-seq of the AaeR regulator

  • Whole-Genome Analysis:

    • Analyze clinical isolates with varying degrees of antimicrobial resistance for mutations or expression changes in aaeA

    • Conduct evolutionary experiments selecting for increased resistance and sequence aaeA locus

For Developing Targeted Inhibitors:

  • High-Throughput Screening Pipeline:

    Table 2: Multi-Stage Screening Approach for AaeA Inhibitors

    Screening StageMethodologyReadoutAdvantages
    Primary ScreenFluorescence-based substrate accumulation assay in AaeAB-expressing bacterial cellsIncreased intracellular fluorescence indicates inhibitionIdentifies compounds with cellular activity
    Secondary ScreenDirect binding assays with purified AaeA (SPR, MST)Binding affinity (Kd)Confirms direct interaction with target
    Tertiary ScreenFunctional reconstitution of AaeAB in proteoliposomesInhibition of substrate transportValidates effect on transport function
    Selectivity ScreenTesting against other efflux systems (AcrAB, MdfA)Differential inhibitionIdentifies AaeA-specific inhibitors
    Toxicity ScreenMammalian cell viability assaysCell survival percentageEliminates cytotoxic compounds
  • Structure-Guided Approach:

    • Solve the structure of AaeA alone and in complex with AaeB

    • Identify potential binding pockets at protein-protein interfaces

    • Perform virtual screening against these binding sites

    • Synthesize and test top computational hits

  • Fragment-Based Drug Discovery:

    • Screen libraries of low-molecular-weight fragments for binding to AaeA

    • Identify binding hot spots using NMR or X-ray crystallography

    • Link, grow, or merge fragments that bind to adjacent sites

    • Optimize resulting compounds for potency and drug-like properties

  • Validation in Relevant Models:

    • Test promising inhibitors in cell culture infection models

    • Evaluate efficacy in combination with existing antibiotics

    • Assess resistance development through serial passage experiments

These experimental designs should be implemented in a coordinated manner, with results from one approach informing the direction of others, ultimately leading to a comprehensive understanding of AaeA's role in antimicrobial resistance and the development of effective targeted inhibitors.

How might comparative genomic approaches inform our understanding of AaeA evolution and function across different bacterial species?

Comparative genomic approaches offer powerful tools for understanding AaeA evolution and function across bacterial species:

Future research using these approaches should focus on:

  • Correlating AaeA sequence variations with substrate specificity differences across species

  • Identifying natural variants with enhanced or altered efflux capabilities

  • Understanding how AaeA coevolves with its partner protein AaeB

  • Mapping the evolutionary trajectory of the entire aae gene cluster in response to different environmental pressures

What potential applications exist for engineered variants of the AaeA protein in biotechnology and pharmaceutical research?

Engineered variants of the AaeA protein offer several promising applications in biotechnology and pharmaceutical research:

  • Bioremediation Technologies:

    • Engineered AaeA-AaeB systems with enhanced specificity for environmental pollutants could be incorporated into bacteria used for bioremediation of aromatic compounds

    • Modified efflux systems could help bacteria survive in contaminated environments while actively removing toxic compounds

  • Drug Discovery Platforms:

    • AaeA proteins could be engineered as biosensors that produce a detectable signal when bound by potential efflux pump inhibitors

    • High-throughput screening systems based on modified AaeA could accelerate the discovery of novel antibacterial compounds

  • Protein Production Systems:

    • Given its role in exporting aromatic compounds, engineered AaeA-containing efflux systems could be used to enhance the secretion of valuable aromatic products in bacterial cell factories

    • Reducing intracellular accumulation of toxic intermediates could improve production yields of pharmaceuticals and fine chemicals

  • Antimicrobial Resistance Research:

    • Engineered AaeA variants with modified substrate specificity could serve as model systems for studying the evolution of efflux-mediated resistance

    • Creating chimeric proteins between AaeA and related membrane fusion proteins could help map the molecular determinants of substrate specificity

  • Vaccine Development:

    • If AaeA is found to be immunogenic and surface-exposed, engineered variants could potentially serve as vaccine candidates against Cronobacter infections

    • Attenuating efflux capability through AaeA engineering could reduce bacterial virulence for live-attenuated vaccine development

These applications would require detailed structural and functional characterization of AaeA, as well as development of reliable systems for expressing and assessing the functionality of engineered variants.

How might systems biology approaches integrate AaeA function into broader models of bacterial stress response and antimicrobial resistance?

Systems biology approaches can provide a comprehensive framework for understanding how AaeA functions within broader bacterial stress response and antimicrobial resistance networks:

Specific research directions could include:

  • Quantifying the energetic cost of AaeA-mediated efflux and its impact on bacterial fitness

  • Modeling the dynamics of AaeA expression in response to fluctuating environmental conditions

  • Predicting the consequences of targeting AaeA in multi-drug treatment strategies

  • Understanding how AaeA contributes to the remarkable adaptability of C. sakazakii across diverse environments

By integrating AaeA function into systems-level models, researchers can develop more effective strategies for combating antimicrobial resistance and design interventions that account for the complex interconnections within bacterial stress response networks.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.