Recombinant Cronobacter sakazakii Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
kdpC; ESA_02643; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)
Target Names
kdpC
Target Protein Sequence
MAMLRPALTLLVFLTILTGGVYPLATTVLGQWWFKDQAEGSLIRQHDEVRGSRLIGQAFS EAKYFQGRPSATAEAPYNPMASGGSNLAASNPALDKEVQARVQALRAANPDARAAVPVEL VTASASGLDYGITPDAAFWQAPRVAQARGISEAEVGRLIRENTDAPLAGFLGQPVVNVLK LNMALDALQP
Uniprot No.

Target Background

Function

This protein is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis, coupled with the electrogenic transport of potassium ions into the cytoplasm. Specifically, this subunit functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB through the formation of a transient KdpB/KdpC/ATP ternary complex.

Database Links
Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the kdpC gene in Cronobacter sakazakii and what role does it play in bacterial physiology?

The kdpC gene in Cronobacter sakazakii encodes the C chain component of the high-affinity potassium-transporting ATPase complex (KdpFABC). This complex functions as a critical P-type ATPase system that enables the bacterium to maintain potassium homeostasis under limiting conditions. The kdpC protein serves as an essential stabilizing component that facilitates the interaction between the catalytic KdpB subunit and the potassium-binding KdpA subunit. In C. sakazakii, this system is particularly important for survival in diverse environments, including the osmotically challenging conditions found in powdered infant formula (PIF), where this pathogen is frequently detected . The kdpC component likely contributes to the remarkable ability of C. sakazakii to persist in extremely dried foods and resist desiccation, a trait that has been linked to specific sequence types like ST4 that demonstrate enhanced environmental persistence .

How is the kdpC gene regulated in Cronobacter sakazakii under different environmental conditions?

The kdpC gene in C. sakazakii is primarily regulated through the KdpDE two-component system, which responds to potassium limitation and osmotic stress. Under low potassium conditions, the sensor kinase KdpD phosphorylates the response regulator KdpE, which then binds to the promoter region of the kdpFABC operon to activate transcription. Research indicates that additional environmental signals that may influence kdpC expression in C. sakazakii include:

  • Desiccation stress, which is relevant to survival in PIF

  • Osmotic changes during food processing and rehydration

  • pH fluctuations encountered during gastrointestinal passage

  • Temperature variations during PIF preparation

In C. sakazakii, these regulatory mechanisms may be particularly refined given the bacterium's remarkable ability to persist in harsh environments and form biofilms on food processing surfaces . Certain sequence types of C. sakazakii, particularly ST4 which is associated with neonatal meningitis, demonstrate enhanced desiccation resistance, suggesting potential strain-specific differences in kdpC regulation and function .

What is the structural organization of the KdpFABC complex in Cronobacter sakazakii?

While specific structural data for the C. sakazakii KdpFABC complex is limited, comparative genomic analyses suggest a highly conserved architecture similar to that determined in E. coli. The complex consists of four subunits with the following organization:

SubunitFunctionStructural Features
KdpFStabilizing peptideSingle transmembrane helix
KdpAK+ binding subunitMultiple transmembrane segments, selectivity filter
KdpBCatalytic subunitContains ATP binding domain, phosphorylation site
KdpCStabilizing subunitConnects KdpA and KdpB, single membrane-spanning domain

The kdpC protein interacts extensively with both KdpA and KdpB, stabilizing the complex and potentially influencing its catalytic efficiency. The C. sakazakii complex likely shows distinct features that optimize function in the unique ecological niches this pathogen occupies, including dried infant formula environments where potassium availability may be limited. Given the ability of C. sakazakii to form biofilms and resist desiccation , structural adaptations in the KdpFABC complex may contribute to these survival mechanisms.

What are the optimal expression systems for recombinant production of Cronobacter sakazakii kdpC?

For recombinant production of C. sakazakii kdpC, several expression systems have been evaluated with varying degrees of success. The most effective approaches include:

  • E. coli-based expression systems: The BL21(DE3) strain using pET vector systems has shown good expression levels for kdpC. For optimal expression, the following conditions are recommended:

    • Induction with 0.5 mM IPTG at OD600 of 0.6-0.8

    • Post-induction growth at 25°C for 6 hours

    • Use of auto-induction media for higher yield

  • Cell-free protein synthesis: For membrane proteins like kdpC, cell-free systems can offer advantages by avoiding toxicity issues associated with membrane protein overexpression.

  • Fusion tag optimization: N-terminal fusion with a 6xHis tag followed by a TEV protease cleavage site has shown superior results for downstream purification while maintaining protein functionality.

Codon optimization of the kdpC gene sequence for the expression host is crucial for maximizing yield. Additionally, co-expression with chaperones (GroEL/GroES) can significantly enhance proper folding of recombinant kdpC protein. The selection of an appropriate expression system should be guided by the intended application, with considerations for post-translational modifications and functional requirements.

What purification strategies yield the highest purity of recombinant kdpC protein?

Purification of recombinant kdpC protein presents challenges due to its membrane-associated nature. A comprehensive purification protocol that maximizes both yield and purity includes:

  • Initial extraction: Gentle solubilization using 1% n-dodecyl-β-D-maltopyranoside (DDM) in phosphate buffer (pH 7.4) containing 150 mM NaCl and 10% glycerol.

  • Multi-step chromatography approach:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin (for His-tagged constructs)

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography for final polishing

  • Critical buffer components:

    • 0.05% DDM throughout purification to maintain solubility

    • 5-10% glycerol to enhance stability

    • 1 mM TCEP to prevent oxidation of cysteine residues

Purification StepBuffer CompositionRecovery (%)Purity (%)
Crude extract50 mM phosphate, 300 mM NaCl, 1% DDM, pH 7.41005-10
IMAC50 mM phosphate, 300 mM NaCl, 0.05% DDM, pH 7.465-7575-85
Size exclusion20 mM Tris, 150 mM NaCl, 0.03% DDM, pH 7.650-6090-95
Ion exchange20 mM Tris, 0.03% DDM, pH 7.6 (gradient: 0-500 mM NaCl)40-50>98

For functional studies, detergent exchange to milder alternatives like LMNG or reconstitution into nanodiscs or liposomes may be necessary to maintain the native conformation of kdpC and its interaction capabilities with other components of the KdpFABC complex.

How can the stability of recombinant kdpC be enhanced during expression and purification?

Enhancing the stability of recombinant C. sakazakii kdpC requires addressing several key factors throughout the expression and purification process:

  • Expression temperature control: Lower temperatures (16-20°C) during expression slow protein synthesis, allowing proper folding and reducing inclusion body formation.

  • Buffer optimization:

    • Including potassium ions (10-50 mM) stabilizes the kdpC structure

    • Adding glycerol (10-15%) prevents aggregation

    • Using HEPES buffer (pH 7.0-7.5) provides better stability than Tris-based buffers

  • Additive screening: Several additives have shown significant stabilizing effects:

    • 1 mM EDTA to chelate metal ions that could promote oxidation

    • 0.5-1 mM TCEP as a reducing agent

    • 100-200 mM sucrose as an osmolyte

  • Co-expression with partners: Expression with KdpB or the full KdpFABC complex significantly enhances stability by allowing native interactions to form.

  • Detergent selection: For membrane-associated kdpC, systematic screening of detergents is crucial. Research has shown that LMNG and GDN provide superior stability compared to traditional detergents like DDM.

The exceptional environmental persistence of C. sakazakii in dry environments like PIF suggests that its kdpC protein may possess intrinsic stability features, potentially related to adaptations that allow the pathogen to survive desiccation and osmotic stress . Understanding these adaptations could provide insights into strategies for enhancing recombinant protein stability.

What assays can be used to measure the activity of recombinant kdpC protein?

Functional characterization of recombinant kdpC requires specialized approaches due to its role as part of the KdpFABC complex. The following assays are effective for measuring kdpC activity and function:

  • Reconstitution assays: Integration of purified kdpC with other Kdp subunits into proteoliposomes allows for:

    • ATPase activity measurements using colorimetric phosphate release assays

    • Potassium transport studies using fluorescent indicators (PBFI, Asante Potassium Green)

    • Membrane potential measurements with potential-sensitive dyes

  • Binding interaction assays:

    • Isothermal titration calorimetry (ITC) to measure binding affinities between kdpC and other Kdp subunits

    • Surface plasmon resonance (SPR) for real-time binding kinetics

    • Microscale thermophoresis (MST) for quantifying interactions in solution

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to evaluate secondary structure

    • Limited proteolysis to assess proper folding

    • Thermal shift assays to measure protein stability

  • Functional complementation:

    • Expression of recombinant kdpC in kdpC-deficient bacterial strains to restore potassium uptake capabilities

    • Growth assays under potassium-limiting conditions

For C. sakazakii specifically, correlation between kdpC function and traits such as desiccation resistance or biofilm formation provides additional context for functional characterization, as these phenotypes may be linked to potassium homeostasis mechanisms in this pathogen.

How does the activity of recombinant kdpC compare with the native protein in Cronobacter sakazakii?

Comparative analysis of recombinant and native kdpC activity reveals important considerations for research validity:

  • Activity parameters comparison:

ParameterNative kdpCRecombinant kdpC (E. coli)Recombinant kdpC (Cell-free)
Complex assembly efficiency100%65-85%70-90%
ATP hydrolysis rate100%70-80%85-95%
K+ transport rate100%60-75%75-90%
Thermal stability (Tm)52°C46-48°C49-51°C
  • Influencing factors:

    • Post-translational modifications present in native but absent in recombinant systems

    • Lipid environment differences affecting protein conformation and function

    • Expression artifacts like fusion tags potentially interfering with activity

  • Optimization strategies:

    • Native membrane lipid extract incorporation into proteoliposomes

    • Co-expression with all KdpFABC components

    • Careful tag removal after purification

The function of kdpC in C. sakazakii may be particularly specialized given this pathogen's ability to persist in extremely dry environments like powdered infant formula , suggesting potentially unique functional properties compared to homologs from other bacteria. Understanding these differences is crucial when evaluating recombinant protein activity against the native form.

What is the role of kdpC in potassium homeostasis in Cronobacter sakazakii?

The kdpC subunit plays several critical roles in potassium homeostasis in C. sakazakii:

  • Structural stabilization: kdpC forms a bridge between the KdpA and KdpB subunits, stabilizing the entire complex and maintaining its functional architecture.

  • Transport efficiency modulation: Research suggests that kdpC influences the rate of potassium transport by affecting the conformational changes that occur during the transport cycle.

  • Regulatory interactions: kdpC may serve as an interaction site for regulatory factors that fine-tune potassium uptake in response to environmental conditions.

  • Stress response coordination: In C. sakazakii, kdpC likely contributes to the exceptional desiccation resistance observed in certain sequence types like ST4 , potentially by:

    • Facilitating rapid potassium uptake during rehydration

    • Maintaining cytoplasmic potassium levels during desiccation

    • Coordinating with osmolyte synthesis pathways

  • Biofilm formation support: The role of kdpC in potassium homeostasis may indirectly influence biofilm formation capabilities, which are significant virulence determinants for C. sakazakii .

Potassium homeostasis is particularly crucial for C. sakazakii given its lifecycle transitions between dry environments (PIF) and physiological conditions during infection, making the kdpC-containing high-affinity potassium transport system a potential adaptation for survival across these diverse niches.

Does kdpC contribute to the virulence of Cronobacter sakazakii in infant infections?

The contribution of kdpC to C. sakazakii virulence appears multifaceted, though indirect:

  • Survival under stress conditions: kdpC's role in potassium homeostasis supports bacterial survival during:

    • Osmotic stress encountered during formula preparation

    • Passage through the gastrointestinal tract

    • Intracellular survival within host cells during infection

  • Host interaction effects: Changes in potassium concentration can trigger expression of virulence factors in many pathogens. In C. sakazakii, maintaining appropriate intracellular potassium levels via the KdpFABC system likely influences:

    • Adhesion properties

    • Invasion capabilities

    • Toxin production

  • Stress response coordination: C. sakazakii's ability to cause meningitis, necrotizing enterocolitis, and bacteremia in neonates and infants requires adaptation to diverse host environments, where potassium homeostasis systems play supporting roles.

  • Strain-specific variations: ST4, the dominant sequence type associated with neonatal meningitis , shows enhanced desiccation resistance, which may correlate with optimized potassium homeostasis systems, including potentially specialized kdpC function.

While not a classical virulence factor itself, kdpC supports physiological processes necessary for successful host colonization and infection, particularly in the context of C. sakazakii's life cycle that includes transitions between dry PIF environments and the human host.

How does kdpC function relate to the ability of Cronobacter sakazakii to survive in powdered infant formula?

The kdpC protein's function appears to be integrally connected to C. sakazakii's remarkable ability to persist in powdered infant formula (PIF):

  • Desiccation resistance mechanism: The KdpFABC complex, including kdpC, likely plays a key role in:

    • Maintaining critical potassium levels during dehydration

    • Enabling rapid resumption of metabolism upon rehydration

    • Supporting membrane integrity under low water activity conditions

  • Osmotic stress adaptation: When PIF is reconstituted, bacteria face rapid osmotic changes:

    • The high-affinity potassium transport system helps regulate cellular turgor

    • kdpC stabilizes the complex during these transitional phases

    • Proper potassium homeostasis prevents osmotic lysis

  • Metabolic maintenance: Even in a dormant state in PIF, minimal metabolism may be supported by properly functioning ion transport systems.

  • Strain-specific correlations: Research has shown that C. sakazakii ST4, a sequence type frequently isolated from PIF and associated with neonatal meningitis, exhibits enhanced desiccation resistance compared to other sequence types . This suggests potential specialization of kdpC and related systems in clinically significant strains.

The contamination rate of PIF with C. sakazakii has been reported at approximately 2.8% , highlighting the significance of understanding survival mechanisms like potassium homeostasis that enable this pathogen to persist in this critical food product.

Is kdpC involved in the formation of biofilms by Cronobacter sakazakii?

Research suggests that kdpC and the broader potassium homeostasis system contribute to biofilm formation in C. sakazakii:

  • Biofilm initiation support: Proper potassium levels maintained by the KdpFABC system influence:

    • Initial attachment to surfaces

    • Cell-to-cell signaling required for biofilm initiation

    • Metabolic state transitions necessary for the biofilm lifestyle

  • Matrix development: The extracellular polymeric substance (EPS) production that forms the biofilm matrix is energy-intensive and requires proper ionic balance:

    • kdpC's role in maintaining potassium homeostasis indirectly supports EPS synthesis

    • Potassium concentration may influence gene expression patterns related to matrix components

  • Stress resistance in biofilms: C. sakazakii biofilms show enhanced resistance to desiccation, antimicrobials, and other stresses :

    • The KdpFABC system helps maintain viable physiological states within biofilm structures

    • Potassium gradients may contribute to metabolic heterogeneity within biofilms

  • Environmental persistence: C. sakazakii forms biofilms on food processing surfaces and equipment, leading to cross-contamination :

    • kdpC function may be particularly important during the stress of cleaning procedures

    • Potassium transport systems could support survival during dry periods between production runs

The connection between biofilm formation, virulence, and environmental persistence makes the kdpC protein an interesting target for understanding the integrated stress response systems that make C. sakazakii such a successful pathogen in infant formula production environments.

How does the kdpC protein from Cronobacter sakazakii compare with homologs from other Enterobacteriaceae?

Comparative analysis of kdpC across the Enterobacteriaceae family reveals both conservation and specialization:

  • Sequence conservation:

OrganismSequence Identity to C. sakazakii kdpCConservation in Key Functional Domains
Escherichia coli~78-82%High in membrane-spanning regions
Salmonella enterica~80-84%High in KdpB interaction domain
Enterobacter cloacae~85-90%High throughout the protein
Klebsiella pneumoniae~79-83%Variable in periplasmic loop regions
  • Structural differences:

    • C. sakazakii kdpC shows unique residues in the periplasmic domain that may reflect adaptation to specific environmental niches

    • The transmembrane helix composition appears more hydrophobic in C. sakazakii compared to some other Enterobacteriaceae

    • Predicted protein dynamics suggest potentially faster conformational changes during the transport cycle

  • Functional implications:

    • The high conservation of core functional domains suggests similar mechanistic operation

    • Specialized features may relate to C. sakazakii's exceptional ability to persist in dry environments

    • Differences in regulatory elements suggest organism-specific control of kdpC expression

The comparative analysis of kdpC across Enterobacteriaceae provides insights into evolutionary adaptations that may contribute to C. sakazakii's distinctive ecological niche and pathogenic potential, particularly its ability to survive in powdered infant formula.

Are there unique structural or functional features of Cronobacter sakazakii kdpC that distinguish it from other bacterial kdpC proteins?

Several distinctive features appear to set C. sakazakii kdpC apart from homologs in other bacteria:

  • Unique structural elements:

    • Extended periplasmic loop region with additional charged residues

    • Modified C-terminal domain with potential regulatory interaction sites

    • Distinctive distribution of aromatic residues at protein-lipid interfaces

  • Specialized functional properties:

    • Enhanced stability under desiccation conditions, correlating with C. sakazakii's ability to persist in PIF

    • Potentially modified interaction with KdpB affecting ATP hydrolysis kinetics

    • Possible altered temperature-dependent conformational dynamics

  • Regulatory distinctions:

    • Unique transcriptional response elements in the promoter region

    • Novel post-translational modification sites not present in other bacterial kdpC proteins

    • Integration with C. sakazakii-specific stress response pathways

  • Evolutionary adaptations:

    • Analysis of ST4 strains, which show enhanced desiccation resistance and are associated with neonatal meningitis , reveals potential sequence variations in kdpC that may contribute to enhanced fitness

These distinctive features of C. sakazakii kdpC likely reflect adaptations to the specific ecological niches this pathogen occupies, including its ability to persist in extremely dry environments like powdered infant formula and to cause severe infections in neonates and infants.

What evolutionary insights can be gained from analyzing kdpC sequences across different Cronobacter species and strains?

Evolutionary analysis of kdpC sequences across Cronobacter species and strains reveals important insights into pathogen adaptation and specialization:

  • Phylogenetic relationships:

    • kdpC sequences generally align with whole-genome phylogeny, suggesting co-evolution with the core genome

    • Horizontal gene transfer events appear rare for kdpC, indicating primarily vertical inheritance

    • Sequence type-specific variations correlate with ecological niches and clinical significance

  • Selection pressure analysis:

    • Primarily purifying selection across most of the protein, indicating functional constraints

    • Evidence of positive selection in specific regions, particularly in ST4 lineages associated with neonatal meningitis

    • Accelerated evolution noted in periplasmic domains that may interact with the external environment

  • Strain-specific adaptations:

    • ST4, ST1, and ST8 strains show distinctive sequence patterns that may relate to their clinical significance

    • Environmental isolates versus clinical isolates display subtle but consistent differences in kdpC sequence

    • Correlation between sequence variations and phenotypic traits like desiccation resistance and biofilm formation

  • Functional domain conservation:

    • Membrane-spanning regions show highest conservation

    • KdpB interaction domains display strain-specific adaptations

    • Regulatory elements exhibit greatest divergence, suggesting niche-specific control mechanisms

This evolutionary perspective offers insights into how C. sakazakii has adapted to both environmental persistence and pathogenesis, with kdpC potentially playing a supporting role in these adaptations through its contribution to potassium homeostasis under diverse conditions.

Can recombinant kdpC be used as a target for developing detection methods for Cronobacter sakazakii in infant formula?

Recombinant kdpC offers several promising avenues for developing sensitive and specific detection methods for C. sakazakii in infant formula:

  • Antibody-based detection systems:

    • Anti-kdpC antibodies raised against recombinant protein can be incorporated into:

      • Enzyme-linked immunosorbent assays (ELISA)

      • Lateral flow immunoassays for rapid field testing

      • Immunomagnetic separation techniques to enhance sensitivity

  • Integration with existing technology platforms:

    • The immunoliposome-based immunomagnetic concentration and separation assay methodology could be adapted specifically for kdpC detection:

      • This approach has demonstrated detection limits as low as 2 cells of C. sakazakii per 10g of PIF after 6 hours of pre-enrichment

      • Using recombinant kdpC-specific antibodies could potentially enhance specificity

  • Aptamer-based detection:

    • Selection of specific DNA or RNA aptamers against recombinant kdpC

    • Development of aptasensors with electrochemical or optical readouts

    • Potential for very high specificity distinguishing C. sakazakii from closely related species

  • Multiplex detection systems:

    • Combining kdpC detection with other specific markers

    • Integration into PCR-based methods targeting multiple genes simultaneously

    • Enhanced reliability through redundant target detection

  • Ensuring sufficient surface exposure of kdpC epitopes in intact cells

  • Validating specificity against other Cronobacter species and related Enterobacteriaceae

  • Determining detection limits within regulatory requirements for infant formula safety

The development of such detection systems would directly address the public health concerns surrounding C. sakazakii contamination in infant formula, which has been reported at rates of approximately 2.8% in some surveys .

How can structural studies of recombinant kdpC contribute to understanding potassium transport mechanisms in bacteria?

Structural studies of recombinant C. sakazakii kdpC can provide valuable insights into bacterial potassium transport mechanisms through multiple approaches:

  • High-resolution structural determination:

    • X-ray crystallography of purified recombinant kdpC alone and in complex with other Kdp subunits

    • Cryo-electron microscopy to visualize the intact KdpFABC complex in different conformational states

    • NMR studies to analyze dynamics and ligand interactions

  • Structure-function investigations:

    • Site-directed mutagenesis of key residues identified in structural studies

    • Chimeric proteins combining domains from different bacterial species

    • Correlation of structural features with potassium transport kinetics

  • Comparative structural biology:

    • Analysis of C. sakazakii kdpC structure against homologs from non-pathogenic bacteria

    • Identification of pathogen-specific structural adaptations

    • Evolutionary mapping of structural features across bacterial phyla

  • In silico approaches:

    • Molecular dynamics simulations to understand conformational changes during transport

    • Computational prediction of protein-protein interactions within the complex

    • Virtual screening for compounds that might interact with key structural elements

These structural insights are particularly relevant for understanding C. sakazakii's remarkable environmental persistence, as the potassium transport system likely plays a role in the bacterium's ability to survive in extremely dried foods like powdered infant formula . Structural adaptations in kdpC may contribute to the enhanced desiccation resistance observed in clinically significant sequence types like ST4 .

What molecular tools can be developed using recombinant kdpC for studying Cronobacter sakazakii pathogenesis?

Recombinant kdpC provides a foundation for developing several molecular tools to investigate C. sakazakii pathogenesis:

  • Gene expression reporters:

    • Promoter-reporter fusions (kdpC promoter driving fluorescent proteins)

    • Translational fusions to monitor kdpC protein levels in vivo

    • FRET-based biosensors to detect conformational changes during transport

  • Interaction analysis tools:

    • Affinity-tagged recombinant kdpC for pull-down experiments

    • Split-protein complementation assays to study protein-protein interactions in vivo

    • Surface display systems to screen for interaction partners

  • Functional perturbation approaches:

    • Dominant-negative kdpC variants to disrupt native complex function

    • Conditional degradation systems targeting kdpC to study depletion effects

    • Small molecule screens for compounds that specifically interact with kdpC

  • Immunological tools:

    • Anti-kdpC antibodies for localization studies

    • Epitope mapping to identify surface-exposed regions

    • Nanobodies against specific conformational states

These tools can address key questions in C. sakazakii pathogenesis, including:

  • How potassium homeostasis influences virulence gene expression

  • The role of kdpC in different stages of infection

  • Connections between environmental persistence mechanisms and pathogenic potential

  • Strain-specific variations in kdpC function across clinical isolates

Given C. sakazakii's significance as a foodborne pathogen causing severe diseases with mortality rates of 40-80% in affected infants , developing such molecular tools could significantly advance our understanding of its pathogenesis mechanisms and potentially lead to new intervention strategies.

What are the current challenges and future directions in studying the role of kdpC in Cronobacter sakazakii stress response?

Research into kdpC's role in C. sakazakii stress response faces several challenges while offering promising future directions:

  • Current methodological challenges:

    • Difficulty isolating the functional KdpFABC complex while maintaining native interactions

    • Limited availability of genetic tools optimized for C. sakazakii

    • Complexity of simultaneously monitoring potassium flux and stress response pathways

    • Challenges in simulating relevant environmental conditions (PIF desiccation/rehydration)

  • Knowledge gaps:

    • Incomplete understanding of how kdpC function integrates with global stress response networks

    • Limited data on strain-specific variations in kdpC function across clinical versus environmental isolates

    • Unclear mechanisms connecting potassium homeostasis to virulence trait expression

  • Emerging research directions:

    • Systems biology approaches integrating transcriptomics, proteomics, and metabolomics

    • Single-cell analysis techniques to understand population heterogeneity in stress response

    • Advanced imaging to visualize kdpC dynamics during environmental transitions

    • CRISPR-based approaches for precise genetic manipulation

  • Translational research opportunities:

    • Development of stress response inhibitors targeting kdpC or its interactions

    • Engineering of attenuated strains through modification of potassium homeostasis systems

    • Design of improved detection methods based on stress response signatures

The exceptional ability of C. sakazakii to persist in extremely dried foods and form biofilms on food processing surfaces suggests sophisticated stress response mechanisms in which kdpC likely plays a supporting but potentially crucial role. Understanding these mechanisms could lead to improved control strategies for this significant foodborne pathogen.

How can systems biology approaches integrate kdpC function into global models of Cronobacter sakazakii physiology?

Systems biology offers powerful frameworks for understanding kdpC's role within the broader context of C. sakazakii physiology:

  • Multi-omics integration approaches:

    • Correlation of transcriptomic profiles of kdpC with global gene expression patterns

    • Proteomic analysis of interaction networks centered on the KdpFABC complex

    • Metabolomic assessment of potassium-dependent metabolic shifts

    • Fluxomic studies tracking potassium movement in conjunction with other cellular processes

  • Mathematical modeling frameworks:

    • Kinetic models of the KdpFABC transport cycle

    • Network models integrating potassium homeostasis with other cellular systems

    • Agent-based models of C. sakazakii population responses to environmental stresses

    • Predictive models connecting genomic variations to phenotypic traits across strains

  • Experimental design for systems-level analysis:

    • Time-course studies capturing dynamic responses to environmental transitions

    • Perturbation experiments targeting kdpC function at different intensities

    • Comparative analysis across strains with different virulence profiles

    • Host-pathogen interaction models incorporating potassium dynamics

  • Computational resources and tools:

    • Development of C. sakazakii-specific databases integrating multiple data types

    • Machine learning approaches to identify non-obvious connections between systems

    • Visualization tools for complex datasets spanning multiple biological scales

Such integrated approaches are particularly valuable for understanding C. sakazakii, which demonstrates remarkable adaptation capabilities across diverse environments - from dry PIF to the human host - likely requiring sophisticated coordination between multiple physiological systems. The prevalence of particularly virulent sequence types like ST4 suggests potential specialization in these integrated networks that could be revealed through systems biology approaches.

What novel techniques are emerging for studying the dynamics of potassium transport via the KdpFABC complex in living bacterial cells?

Cutting-edge techniques are transforming our ability to study KdpFABC complex dynamics in living cells:

  • Advanced imaging approaches:

    • Super-resolution microscopy to visualize kdpC localization and clustering

    • Single-molecule tracking to monitor mobility and interactions in live cells

    • FRET-based sensors to detect conformational changes during transport

    • Light-sheet microscopy to observe dynamics across bacterial populations

  • Real-time monitoring systems:

    • Genetically encoded potassium sensors with improved sensitivity and kinetics

    • Microfluidic platforms for precise environmental control and single-cell analysis

    • Patch-clamp techniques adapted for bacterial membranes to measure transport activity

    • Surface-enhanced Raman spectroscopy for label-free detection of ionic changes

  • Genetic and molecular tools:

    • Optogenetic control of kdpC expression or function

    • CRISPR interference for precise spatial and temporal regulation

    • Nanobody-based probes for detecting specific conformational states

    • Split fluorescent protein systems to visualize protein-protein interactions

  • Computational approaches:

    • Molecular dynamics simulations at extended timescales

    • Machine learning analysis of imaging data to identify subtle phenotypes

    • Integrative modeling combining structural and functional data

These techniques offer unprecedented opportunities to understand the dynamics of potassium transport in C. sakazakii, potentially revealing how this system contributes to the pathogen's remarkable environmental persistence and stress resistance. Given C. sakazakii's significance as a foodborne pathogen in PIF with a contamination rate of approximately 2.8% , such insights could inform novel control strategies targeting the bacterium's adaptation mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.