Recombinant Cronobacter sakazakii Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction to Lgt in Cronobacter sakazakii

Prolipoprotein diacylglyceryl transferase (Lgt) is an essential inner-membrane enzyme in Gram-negative bacteria that catalyzes the first step of lipoprotein maturation. In Cronobacter sakazakii, a pathogen linked to severe neonatal infections, Lgt modifies prolipoproteins by transferring a diacylglyceryl moiety from phosphatidylglycerol to a conserved cysteine residue in the lipobox sequence ([LVI][ASTVI][GAS]C) . This modification is critical for anchoring lipoproteins to the membrane and enabling downstream processing by LspA (signal peptidase II) and Lnt (N-acyl transferase) . Recombinant Lgt refers to the enzyme produced via heterologous expression systems for structural, functional, and inhibitor-screening studies.

Catalytic Mechanism

Lgt transfers the sn-1,2-diacylglyceryl group from phosphatidylglycerol to the thiol group of the conserved cysteine in prolipoproteins, forming a thioether bond . This step is indispensable for bacterial viability, as genetic depletion of lgt leads to outer membrane destabilization and cell death .

Topology and Conserved Motifs

Studies in Escherichia coli reveal that Lgt is anchored via seven transmembrane domains, with its N-terminus facing the periplasm and C-terminus oriented cytoplasmically . Key residues (e.g., Y26, N146, G154) in the Lgt signature motif (periplanar-facing) are essential for enzymatic activity . Homology modeling suggests C. sakazakii Lgt shares similar topology due to high sequence conservation (~50% identity with E. coli Lgt) .

Table 1: Comparative Features of Lgt Across Gram-Negative Bacteria

FeatureC. sakazakii (Inferred)E. coli (Reference)A. baumannii (Reference)
Gene length (bp)~900888897
Transmembrane domains777
Essential residuesY26, N146, G154Y26, N146, G154Y25, N145, G153
InhibitorsNot yet identifiedG2823, G2824 G2823, G2824

Inhibitor Development

Macrocyclic compounds (e.g., G2823, G2824) inhibit E. coli Lgt by binding its active site, leading to:

  • Accumulation of unmodified prolipoproteins (e.g., pro-Lpp) .

  • Outer membrane blebbing and increased antibiotic susceptibility .

  • Bactericidal activity (MIC: 2–8 µg/mL against wild-type strains) .

These inhibitors do not exhibit cross-resistance with LspA or LolCDE inhibitors, highlighting target specificity .

Role in C. sakazakii Pathogenesis

Though direct evidence is sparse, Lgt’s role in lipoprotein maturation suggests it contributes to virulence by enabling:

  • Membrane integrity: Critical for resisting serum complement and antibiotics .

  • Virulence factor secretion: Lipoproteins mediate adhesion, nutrient acquisition, and immune evasion .

  • Stress adaptation: C. sakazakii’s pan-genome includes genes for osmotic stress survival, potentially linked to lipoprotein function .

Table 2: Phenotypic Effects of Lgt Inhibition in Model Bacteria

PhenotypeE. coli Lgt DepletionA. baumannii Lgt Inhibition
Outer membrane permeabilityIncreased SYTOX Green uptake Similar to E. coli
Cell morphologyEnlarged cell size Not reported
In vivo attenuationReduced survival in murine bacteremia Not studied

Genomic and Evolutionary Insights

C. sakazakii’s accessory genome encodes niche-specific adaptations, including proton transport and antibiotic resistance genes (e.g., fos, mdf(A)) . While Lgt itself is part of the core genome, its conserved sequence suggests it is under strong purifying selection, making it a stable antibacterial target . Recombination events in lipoprotein-related genes (e.g., lpp) may influence resistance mechanisms .

Challenges and Future Directions

  1. Structural studies: Cryo-EM or X-ray crystallography of recombinant C. sakazakii Lgt is needed to design species-specific inhibitors.

  2. In vivo validation: Assess Lgt’s role in C. sakazakii infection models (e.g., neonatal meningitis).

  3. Resistance profiling: Monitor for mutations in clinical isolates exposed to Lgt inhibitors.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently available in our inventory. However, if you have specific format requirements, kindly indicate them in your order notes. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery details.
Note: All our proteins are shipped standard with normal blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing it according to your specifications.
Synonyms
lgt; ESA_00481; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)
Target Names
lgt
Target Protein Sequence
MNSGYLHFPDFDPVIFSLGPVSLHWYGLMYLVGFVFAMWLAVRRANRPGSGWTKNEVENL LYAGFLGVFLGGRIGYVLFYNLPLFLENPLYLFRVWDGGMSFHGGLIGVICVMIWFAKRT KRNFFQVSDFIAPLIPFGLGAGRLGNFINGELWGRVDPGFPYAMLFPGSRSEDIGLLASH PEWQSLFNTYGVLPRHPSQLYELFLEGIVLFIILNLFIRKPRPMGAVSGLFLIGYGAFRI IVEFFRQPDAQFTGEWVQYISMGQILSIPMIVAGAAMMIWAYRRRPQQQLS
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein, which is the first step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.