Recombinant Cronobacter sakazakii Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
crcB; ESA_02703; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)
Target Names
crcB
Target Protein Sequence
MLKIMLAVFLGGGTGSVLRWWLGLRLNPVHHAIPVGTLTANLAGAFIIGAGLAWFNRMTH LDPMWKLLVTTGLCGGLTTFSTFSAEVVFLLQEGRIGWAGLNVALNLFGSFMMTALAFWL FSSLSVR
Uniprot No.

Target Background

Function

Crucial for reducing intracellular fluoride concentration and its associated toxicity.

Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the CrcB homolog in Cronobacter sakazakii and what is its primary function?

The CrcB homolog in C. sakazakii belongs to a family of membrane proteins that typically function as fluoride ion channels or transporters in bacteria. These proteins are crucial for bacterial survival in environments containing fluoride, as they provide protection against fluoride toxicity by exporting fluoride ions from the cytoplasm. In C. sakazakii, the CrcB homolog likely contributes to environmental stress resistance mechanisms.

Methodologically, the function of CrcB can be investigated through:

  • Gene knockout studies followed by growth assays in fluoride-containing media

  • Heterologous expression in systems lacking endogenous fluoride transporters

  • Fluoride uptake/efflux assays using fluoride-sensitive electrodes

  • Protein purification followed by reconstitution in proteoliposomes for transport studies

How is the crcB gene identified and characterized in the C. sakazakii genome?

The crcB gene in C. sakazakii can be identified through whole genome sequencing and subsequent bioinformatic analysis. As demonstrated in comparative genomic studies of C. sakazakii isolates, genes of interest can be identified through:

  • Whole genome sequencing using platforms such as Ion Torrent Proton

  • Assembly of genomic DNA using appropriate software

  • Gene prediction and annotation using tools like RAST or Prokka

  • Comparative analysis with known crcB sequences from other bacteria

  • Confirmation of gene identity through PCR and Sanger sequencing

Similar to other C. sakazakii studies, libraries can be generated by enzyme fragmentation and constructed using appropriate kits like NEBNext Fast DNA-Library kits, followed by quality control using systems such as Agilent Bioanalyzer 2100 .

What expression systems are most effective for producing recombinant C. sakazakii CrcB protein?

For effective recombinant expression of membrane proteins like CrcB from C. sakazakii, several expression systems can be considered:

  • E. coli-based expression:

    • BL21(DE3) or C43(DE3) strains (optimized for membrane protein expression)

    • pET vector systems with inducible promoters

    • Fusion tags (His6, MBP, or SUMO) to aid solubility and purification

  • Yeast expression systems:

    • Pichia pastoris for high-yield membrane protein expression

    • Saccharomyces cerevisiae for proper folding and post-translational modifications

  • Cell-free expression systems:

    • Wheat germ extract for difficult-to-express membrane proteins

    • E. coli-based cell-free systems with added detergents or nanodiscs

Methodologically, optimization requires:

  • Screening multiple constructs with varying N- and C-terminal boundaries

  • Testing different induction conditions (temperature, inducer concentration, duration)

  • Evaluating various detergents for extraction and purification

  • Validating protein folding and function through activity assays

How does the structure of C. sakazakii CrcB compare to homologs in other bacteria, and what implications does this have for function?

Analyzing the structure-function relationship of C. sakazakii CrcB requires:

  • Comparative sequence analysis:

    • Multiple sequence alignment with CrcB proteins from diverse bacterial species

    • Identification of conserved residues and domains

    • Prediction of transmembrane topology

  • Structural determination approaches:

    • X-ray crystallography of purified CrcB (challenging for membrane proteins)

    • Cryo-electron microscopy for high-resolution structural analysis

    • NMR spectroscopy for dynamic studies of specific domains

    • Computational modeling based on homologous proteins with known structures

  • Functional validation:

    • Site-directed mutagenesis of predicted key residues

    • Fluoride transport assays with mutant proteins

    • Cross-linking studies to determine oligomeric state

Based on studies of other bacterial membrane transporters, researchers should consider the potential for CrcB to form multimeric complexes and interact with other membrane components, as observed with other transporters in C. sakazakii .

What role might CrcB play in C. sakazakii stress response and virulence mechanisms?

C. sakazakii is known for its ability to survive under various stress conditions, including desiccation in powdered infant formula. Investigating CrcB's role in stress response requires:

  • Stress challenge experiments:

    • Create crcB knockout mutants

    • Expose wild-type and mutant strains to various stressors (desiccation, heat, acid, osmotic stress)

    • Measure survival rates and growth recovery

    • Complement mutants to confirm phenotype specificity

  • Virulence assessments:

    • Cell invasion assays using human intestinal epithelial cells and brain microvascular endothelial cells

    • Animal models to evaluate colonization and dissemination

    • Transcriptomic analysis of crcB expression during infection

  • Integration with known virulence mechanisms:

    • Evaluate potential interactions with known virulence factors

    • Assess impact on biofilm formation, which is known to be important for C. sakazakii virulence

    • Investigate potential role in desiccation resistance, which contributes to persistence in powdered infant formula

How does temperature affect the expression and function of CrcB in C. sakazakii?

Given that C. sakazakii exhibits different growth characteristics at various temperatures (22°C vs. 35°C) , temperature effects on CrcB can be investigated through:

  • Expression analysis across temperatures:

    • qRT-PCR to measure crcB transcript levels at different temperatures

    • Western blotting to quantify protein levels

    • Reporter gene fusions to monitor promoter activity

  • Functional assays at different temperatures:

    • Fluoride tolerance testing at various temperatures

    • Membrane fluidity assessments using fluorescent probes

    • Protein stability and folding analysis through circular dichroism

  • Physiological impact assessment:

    • Growth kinetics of wild-type vs. crcB mutants at different temperatures

    • Competitive growth assays under fluoride stress at various temperatures

    • Proteomic analysis to identify temperature-dependent interaction partners

These investigations would be particularly relevant considering C. sakazakii's rapid growth in reconstituted powdered infant formula at 35°C (human body temperature) with generation times as low as 0.41 hours .

What purification strategies yield the highest quality recombinant CrcB protein for structural studies?

Purifying membrane proteins like CrcB presents unique challenges. A comprehensive approach includes:

  • Detergent screening:

    • Systematic testing of detergents (DDM, LMNG, MNG-3, etc.)

    • Assessment of protein stability using size-exclusion chromatography

    • Thermostability assays to identify optimal conditions

  • Purification workflow:

    • Affinity chromatography using engineered tags (His6, FLAG, etc.)

    • Ion exchange chromatography for additional purity

    • Size exclusion chromatography for final polishing

    • Quality assessment using SDS-PAGE, Western blotting, and mass spectrometry

  • Alternative membrane mimetics:

    • Reconstitution into nanodiscs or SMALPs for detergent-free environments

    • Amphipol exchange for enhanced stability

    • Lipid cubic phase formulation for crystallization trials

  • Scale-up considerations:

    • Bioreactor cultivation for high cell density

    • Tangential flow filtration for efficient cell harvesting

    • Automated purification systems for reproducibility

How can functional assays be designed to assess CrcB-mediated fluoride transport in C. sakazakii?

Methodologically robust functional assays include:

  • Fluoride electrode-based measurements:

    • Whole-cell fluoride uptake/efflux assays

    • Proteoliposome-reconstituted transport assays

    • Kinetic characterization (Km, Vmax determination)

  • Fluorescent probe approaches:

    • SNAFL-based intracellular pH measurement during fluoride transport

    • Membrane potential-sensitive dyes to assess electrogenicity

    • FRET-based sensors for real-time transport monitoring

  • Genetic complementation assays:

    • Heterologous expression in fluoride-sensitive E. coli strains

    • Cross-species complementation tests

    • Chimeric protein analysis to identify functional domains

  • Electrophysiological methods:

    • Patch-clamp analysis of reconstituted CrcB

    • Planar lipid bilayer recordings

    • Solid-supported membrane electrophysiology

What bioinformatic approaches can identify potential regulatory elements controlling crcB expression in C. sakazakii?

Comprehensive bioinformatic analysis should include:

  • Promoter region analysis:

    • Identification of -10 and -35 elements

    • Prediction of transcription factor binding sites

    • Comparative genomics across Cronobacter species to identify conserved elements

  • Regulatory network identification:

    • Analysis of genomic context and operonic structure

    • Riboswitch prediction, particularly fluoride-responsive elements

    • Identification of small RNAs that might regulate crcB

  • Empirical validation approaches:

    • 5' RACE to identify transcription start sites

    • Reporter fusion assays to test promoter activity

    • DNA-protein interaction studies (EMSA, ChIP-seq) to confirm regulatory factors

    • RNA-seq analysis under various conditions to identify co-regulated genes

How can researchers distinguish between primary and secondary effects when analyzing phenotypes of crcB mutants in C. sakazakii?

Rigorous phenotypic analysis requires:

  • Genetic controls:

    • Multiple independent crcB mutant strains

    • Complementation with wild-type and site-directed mutants

    • Dose-dependent expression systems to correlate phenotype with expression level

  • Temporal analysis:

    • Time-course experiments to distinguish immediate from adaptive responses

    • Pulse-chase studies to track cellular components

    • Real-time monitoring of physiological parameters

  • Multi-omics integration:

    • Transcriptomics to identify compensatory gene expression

    • Proteomics to detect post-transcriptional effects

    • Metabolomics to assess global metabolic changes

    • Network analysis to map primary and secondary effect cascades

  • Systematic perturbation approaches:

    • Chemical genetic profiling with sub-inhibitory compound concentrations

    • Synthetic genetic array analysis to identify genetic interactions

    • Suppressor mutation screening to identify compensatory pathways

What statistical approaches are most appropriate for analyzing CrcB protein-protein interaction networks in C. sakazakii?

Robust statistical analysis should include:

  • Interaction detection methods:

    • Co-immunoprecipitation followed by mass spectrometry

    • Bacterial two-hybrid or split-GFP assays

    • Proximity labeling techniques (BioID, APEX)

    • Cross-linking mass spectrometry

  • Network construction approaches:

    • Scoring systems for interaction confidence

    • Weighted networks based on interaction strength

    • Directionality assessment where applicable

    • Integration with publicly available interaction databases

  • Statistical validation:

    • False discovery rate control using appropriate methods

    • Permutation tests to establish significance thresholds

    • Bootstrapping to assess network stability

    • Bayesian approaches for confidence estimation

  • Biological context integration:

    • Enrichment analysis for functional categories

    • Comparison with known protein complexes

    • Evolutionary conservation analysis

    • Integration with transcriptomic data to identify dynamic interactions

How can researchers effectively compare CrcB function across different Cronobacter species and strains?

Methodological approaches for comparative analysis include:

  • Standardized functional assays:

    • Identical expression systems for heterologous production

    • Consistent buffer conditions and substrate concentrations

    • Parallel purification protocols

    • Normalized protein-to-lipid ratios in reconstitution experiments

  • Phylogenetic framework:

    • Maximum likelihood or Bayesian phylogenetic analysis

    • Ancestral state reconstruction

    • Selection pressure analysis (dN/dS ratios)

    • Identification of lineage-specific adaptations

  • Structural comparisons:

    • Homology modeling based on available structures

    • Molecular dynamics simulations

    • Conservation mapping onto structural models

    • Identification of species-specific structural features

  • Ecological and clinical correlations:

    • Association of functional differences with ecological niches

    • Correlation with virulence in clinical isolates

    • Analysis of horizontal gene transfer events

    • Adaptive significance assessment

This comparative approach should consider the genomic diversity observed in Cronobacter species, as indicated by previous studies that identified various Cronobacter species in environmental samples .

What are the common pitfalls in recombinant expression of C. sakazakii CrcB, and how can they be addressed?

Researchers should be aware of these common challenges:

  • Expression issues:

    ChallengePotential Solutions
    Toxic expressionUse tightly regulated promoters; C43(DE3) strain; lower induction temperature
    Inclusion body formationTry fusion partners (MBP, SUMO); co-express chaperones; optimize induction conditions
    Poor yieldCodon optimization; high cell-density fermentation; test alternative tags
    Proteolytic degradationAdd protease inhibitors; remove recognition sites; use protease-deficient strains
  • Solubilization challenges:

    ChallengePotential Solutions
    Inefficient extractionScreen detergent panel; optimize detergent:protein ratio; test mixed micelles
    Aggregation post-extractionAdd stabilizing additives; test amphipols; maintain critical micelle concentration
    Loss of functionTry milder detergents; native lipid addition; rapid purification protocols
  • Purification obstacles:

    ChallengePotential Solutions
    Poor binding to affinity resinAdjust tag position; optimize buffer conditions; try alternative tags
    Co-purifying contaminantsAdd secondary purification steps; on-column washing optimization
    Elution difficultiesTest different elution conditions; consider proteolytic tag removal

How can researchers troubleshoot inconsistent results in CrcB functional assays?

Systematic troubleshooting approaches include:

  • Protein quality assessment:

    • Verify protein integrity through SDS-PAGE and mass spectrometry

    • Assess oligomeric state using native PAGE or size exclusion chromatography

    • Confirm proper folding through circular dichroism or fluorescence spectroscopy

    • Validate orientation in reconstituted systems

  • Assay component validation:

    • Test reagent quality and prepare fresh solutions

    • Calibrate instruments and validate with positive controls

    • Check buffer composition and pH

    • Evaluate membrane/liposome integrity

  • Experimental conditions optimization:

    • Systematically vary temperature, pH, and ionic strength

    • Determine time-dependent effects through kinetic measurements

    • Assess potential inhibitors or activators in the system

    • Control for non-specific binding or transport

  • Data analysis refinement:

    • Apply appropriate background subtraction methods

    • Use internal controls for normalization

    • Consider alternative curve fitting models

    • Implement statistical tests for reproducibility

What strategies can overcome challenges in crystallizing C. sakazakii CrcB for structural studies?

Membrane protein crystallization requires specialized approaches:

  • Pre-crystallization optimization:

    • Construct screening to identify stable variants

    • Thermostability assays to guide condition selection

    • Surface entropy reduction to promote crystal contacts

    • Monodispersity assessment through FSEC

  • Crystallization methods:

    MethodAdvantagesConsiderations
    Vapor diffusionStandard approach; easy setupOften yields type II crystals
    Lipidic cubic phaseNative-like environment; type I crystalsComplex setup; special equipment
    Bicelle crystallizationIntermediate approachTemperature-sensitive
    Microfluidic platformsMinimal protein consumptionSpecialized devices required
  • Additive strategies:

    • Antibody fragments or nanobodies to stabilize conformation

    • Conformation-specific ligands or inhibitors

    • Engineered fusion partners (T4 lysozyme, BRIL)

    • Lipid/detergent screening for optimal micelle size

  • Alternative structural approaches:

    • Cryo-EM for single-particle analysis

    • NMR for dynamic studies of domains

    • Cross-linking mass spectrometry for topology validation

    • EPR spectroscopy for distance measurements

How might structural information about CrcB inform the development of novel antimicrobial strategies against C. sakazakii?

Advanced research in this direction should consider:

  • Structure-based drug design approaches:

    • Virtual screening against predicted binding pockets

    • Fragment-based drug discovery targeting CrcB

    • Rational design of transport inhibitors

    • Allosteric modulator identification

  • Potential antimicrobial strategies:

    • CrcB inhibitors combined with fluoride to enhance toxicity

    • Development of channel blockers specific to bacterial CrcB

    • Exploitation of structural differences between bacterial and mammalian fluoride transporters

    • Combination approaches targeting multiple transporters simultaneously

  • Resistance mechanism considerations:

    • Prediction of potential resistance mutations

    • Design of inhibitors with high barriers to resistance

    • Dual-targeting approaches to reduce resistance development

    • Exploitation of fitness costs associated with resistance

  • Translational research pathways:

    • In vitro to in vivo efficacy translation

    • Formulation strategies for infant formula applications

    • Safety assessment in mammalian systems

    • Regulatory considerations for food safety applications

This direction is particularly relevant given the identification of multiple antibiotic resistance genes in C. sakazakii and its ability to cause serious infections in infants .

What potential roles might CrcB play in C. sakazakii biofilm formation and persistence in food production environments?

This research question addresses key aspects of C. sakazakii food safety:

  • Biofilm contribution assessment:

    • Compare biofilm formation between wild-type and crcB mutants

    • Evaluate structural differences in biofilm matrix

    • Assess biofilm resistance to sanitizers and antibiotics

    • Investigate cell-cell communication in biofilms

  • Environmental persistence factors:

    • Desiccation tolerance in relation to CrcB function

    • Temperature fluctuation responses

    • Survival on food contact surfaces

    • Recovery from viable but non-culturable states

  • Multi-species interactions:

    • Co-culture studies with other food production environment microorganisms

    • Impact on horizontal gene transfer frequencies

    • Competitive or cooperative behaviors in mixed biofilms

    • Influence on quorum sensing systems

  • Control strategy development:

    • Targeted anti-biofilm approaches based on CrcB function

    • Synergistic combinations with existing sanitizers

    • Environmental modifications to reduce persistence

    • Early detection methodologies for biofilm-forming strains

These investigations would build upon previous findings regarding C. sakazakii's ability to form biofilms under various conditions and its notable desiccation resistance .

How does the evolution of CrcB in C. sakazakii compare to other enteric pathogens, and what insights might this provide into bacterial adaptation?

Evolutionary analysis approaches include:

  • Comparative genomic analysis:

    • Phylogenetic reconstruction of CrcB across enteric bacteria

    • Identification of horizontal gene transfer events

    • Analysis of selection pressures (positive, negative, balancing)

    • Investigation of gene duplication and divergence patterns

  • Functional evolution assessment:

    • Ancestral sequence reconstruction and functional testing

    • Identification of critical evolutionary transitions

    • Correlation with habitat transitions or host range expansion

    • Experimental evolution under selective conditions

  • Structural evolution mapping:

    • Tracking of structurally important residues through evolution

    • Identification of co-evolving residue networks

    • Prediction of function-altering mutations

    • Molecular dynamics simulations of ancestral and extant proteins

  • Ecological correlations:

    • Association of CrcB variants with specific ecological niches

    • Correlation with fluoride levels in natural habitats

    • Relationship to other stress response mechanisms

    • Connection to pathogenicity and host range

This evolutionary perspective could contribute to understanding why certain strains of C. sakazakii are associated with foodborne outbreaks and clinical cases, as indicated by the prevalence of specific clonal complexes in surveillance studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.