Recombinant Cronobacter sakazakii Rhomboid protease glpG homolog (glpG)

Shipped with Ice Packs
In Stock

Description

Biological Functions

While C. sakazakii GlpG’s exact role is understudied, homologs in related bacteria provide functional clues:

OrganismFunctionReference
Escherichia coliRegulates glycerol metabolism and promotes gut persistence by degrading misfolded proteins .
Shigella sonneiMediates quality control of orphan respiratory complex subunits (e.g., HybA, FdnH) .
C. sakazakiiHypothesized to influence virulence via membrane protein remodeling, akin to OmpX .

Production Workflow:

  1. Cloning: glpG gene (ESA_04318) inserted into expression vectors.

  2. Expression: Host systems (e.g., E. coli) induced to produce the protein.

  3. Purification: Affinity chromatography followed by buffer exchange into Tris-glycerol storage solutions .

Research Applications:

  • Enzymatic Studies: Used to investigate intramembrane proteolysis mechanisms .

  • Pathogenesis Models: Potential tool for exploring C. sakazakii virulence, given its homology to E. coli GlpG .

  • Vaccine Development: Recombinant outer membrane proteins (e.g., OmpX) from C. sakazakii show immunogenic potential, suggesting GlpG could be explored similarly .

Catalytic Mechanism:

  • GlpG cleaves substrates via nucleophilic attack by Ser-201, stabilized by His-254. Structural studies with DFP confirm a tetrahedral intermediate during hydrolysis .

  • Unlike soluble serine proteases, GlpG’s active site is buried within the membrane, necessitating unique substrate docking mechanisms .

Role in Bacterial Fitness:

  • In E. coli, GlpG supports intestinal colonization by degrading malformed membrane proteins, linking it to persistence in host environments .

  • S. sonnei GlpG selectively targets orphan subunits of respiratory complexes (e.g., HybA), preventing toxic buildup of unassembled proteins .

Challenges and Future Directions

  • Substrate Specificity: Identification of native substrates in C. sakazakii remains a hurdle .

  • Therapeutic Potential: Structural insights into GlpG’s active site could guide inhibitor design against pathogenic rhomboid proteases .

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement. We will accommodate your request whenever possible.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.

Synonyms
glpG; ESA_04318; Rhomboid protease GlpG homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)
Target Names
glpG
Target Protein Sequence
MLMINSFDNPRLAQAFVDYMATQGVILEIQRHDTWDIWLADEAQAERVKAELSYFLAHPG DPRYLSASWQTGQLNAGLRYRSYPFMASVRAHAGPLTLGMMALCVVAYLAMSIIGSPQVA VWLAWPFDPSLKFQLWRYVSPLLLHFSLLSLIFNLLWWWYLAGPLERSVGSGKLLTLTLV TALVGGVIQYQIAGPWFGGLGGVVYALVGYVWLRGEREPESGLYLPRGILVFMLLWLAIG GLGLFGNKTANADLVAGMLIGLAMAMTDTLHARKRK
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase S54 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Cronobacter sakazakii and why is its glpG protein significant?

Cronobacter sakazakii is an opportunistic foodborne pathogen known for its ability to survive in extremely arid environments such as powdered infant formula (PIF), making it particularly dangerous for infants and neonates. The pathogen can cause severe invasive infections including septicemia, necrotizing enteritis, and meningitis . The rhomboid protease glpG homolog in C. sakazakii is significant as it belongs to a family of intramembrane serine proteases that play important roles in bacterial membrane protein regulation, potentially contributing to stress response mechanisms that allow this organism to survive harsh environmental conditions .

How does glpG function differ between Cronobacter sakazakii and other bacterial species?

The glpG homolog in C. sakazakii, like other rhomboid proteases, likely functions within the cell membrane to cleave transmembrane substrate proteins. While the core catalytic mechanism is conserved across bacterial species, differences in substrate specificity and regulation may exist. In C. sakazakii, glpG may have evolved specific roles related to the organism's unique stress tolerance mechanisms that enable survival in desiccated environments . The protein appears to involve topological constraints and modular structure in its folding, and studies have shown that thermodynamically destabilizing mutations can paradoxically accelerate GlpG's folding in detergent micelles .

What are the basic structural characteristics of C. sakazakii glpG?

C. sakazakii glpG is a membrane-embedded rhomboid protease with multiple transmembrane domains. The protein adopts a structure where the catalytic residues (typically serine and histidine) are positioned within the membrane bilayer to facilitate intramembrane proteolysis. The folding of GlpG involves topological constraints and modular structures that influence its stability and function . Like other rhomboid proteases, it likely contains a core catalytic domain with approximately 6 transmembrane segments and may have additional regulatory domains depending on the specific homolog.

How do stress conditions affect the expression and activity of native glpG in Cronobacter sakazakii?

The expression and activity of native glpG in C. sakazakii likely responds to various stress conditions that the organism encounters. Research indicates that C. sakazakii possesses remarkable stress response mechanisms that allow it to survive in extremely dry conditions. Under heat stress (50°C), the probability of cell growth (Pg) decreases as treatment time increases, with different recovery patterns observed at different temperatures (5, 10, 15, and 25°C) . To investigate glpG's role in stress response, researchers should design experiments comparing glpG expression levels under various stress conditions (osmotic, heat, acid stress) using qRT-PCR, and correlate these with bacterial survival rates. Mutations in glpG might alter stress response profiles, suggesting its potential role in membrane protein quality control during stress adaptation .

What is the role of glpG in Cronobacter sakazakii virulence and host cell invasion?

While the specific role of glpG in C. sakazakii virulence has not been definitively established from the provided search results, the protein may contribute to pathogenicity through regulation of membrane protein composition. C. sakazakii must infect cells of the inner gut lining or cross this barrier to reach the bloodstream to cause systemic infections. The bacterium has been shown to infect mucous membranes, gastric and intestinal epithelial, and endothelial tissues . Research methodologies to investigate glpG's role in virulence would include:

  • Creating glpG knockout mutants and comparing their invasion efficiency in cell culture models

  • Analyzing changes in outer membrane protein profiles in wild-type versus glpG mutants

  • Performing in vivo infection experiments to compare virulence between wild-type and glpG-deficient strains

  • Investigating potential glpG substrates involved in adhesion or invasion using proteomic approaches

How do post-translational modifications affect C. sakazakii glpG activity and substrate specificity?

Post-translational modifications (PTMs) may significantly impact C. sakazakii glpG activity and substrate specificity. Potential PTMs affecting glpG function could include phosphorylation, glycosylation, or lipid modifications. To investigate these effects, researchers should:

  • Use mass spectrometry to identify native PTMs on purified glpG from C. sakazakii

  • Generate site-directed mutants at potential modification sites

  • Compare enzymatic activity of modified versus unmodified forms of the protein

  • Analyze substrate cleavage patterns using fluorogenic peptide libraries or proteomics approaches

The topological constraints and folding characteristics of glpG suggest that structural modifications could significantly alter its function . Researchers should consider how membrane composition and environmental factors might influence these modifications.

What are the molecular determinants of substrate specificity in C. sakazakii glpG?

The molecular determinants of substrate specificity in C. sakazakii glpG likely include specific amino acid sequences or structural features that facilitate substrate recognition and binding. To investigate these determinants:

  • Perform comparative sequence analysis of glpG across different bacterial species to identify conserved and variable regions

  • Create chimeric proteins by swapping domains between C. sakazakii glpG and other rhomboid proteases with different specificities

  • Use site-directed mutagenesis to alter key residues in potential substrate-binding regions

  • Employ computational modeling to predict substrate-enzyme interactions based on the thermodynamic folding properties identified in GlpG studies

What are the optimal methods for purifying active recombinant C. sakazakii glpG?

Purifying active recombinant C. sakazakii glpG requires careful consideration of its membrane protein nature. The following methodology is recommended:

  • Expression optimization: Express in E. coli strains optimized for membrane proteins (C41, C43, or Lemo21) with a C-terminal His6-tag to avoid interfering with potential N-terminal signal sequences.

  • Membrane extraction: Harvest cells, lyse by sonication or French press, and isolate membranes by ultracentrifugation at 100,000 × g for 1 hour at 4°C.

  • Solubilization: Solubilize membrane fractions using mild detergents such as n-Dodecyl-β-D-maltoside (DDM) or n-Decyl-β-D-maltoside (DM) at 1-2% concentration in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl.

  • Affinity purification: Apply the solubilized protein to Ni-NTA resin, wash extensively with 20-40 mM imidazole, and elute with 250-300 mM imidazole.

  • Size exclusion chromatography: Further purify using gel filtration in buffer containing 0.05-0.1% detergent to maintain protein stability.

The purification strategy should consider that GlpG folding involves specific topological constraints and modular structures that can be affected by detergent conditions .

What assays can be used to measure C. sakazakii glpG proteolytic activity?

Several assays can be employed to measure C. sakazakii glpG proteolytic activity:

  • Fluorogenic peptide substrates: Design peptides containing known rhomboid protease cleavage sites with a fluorophore and quencher pair. Cleavage separates the pair, resulting in measurable fluorescence increase.

  • FRET-based assays: Use fusion proteins with fluorescent proteins (e.g., CFP-substrate-YFP) where proteolytic cleavage disrupts FRET signal.

  • Western blot analysis: Incubate glpG with potential substrate proteins and analyze cleavage products using antibodies against substrate epitopes.

  • Mass spectrometry: Identify cleavage sites precisely by analyzing substrate fragments after incubation with glpG.

  • In vivo reporter systems: Create fusion proteins where substrate cleavage releases a reporter protein (e.g., β-galactosidase), allowing activity assessment in living cells.

When developing these assays, consider that temperature significantly affects C. sakazakii growth rates (optimal at 35°C with generation time of 0.41 h compared to 0.67 h at 22°C) , which may influence native glpG activity.

How can researchers generate specific antibodies against C. sakazakii glpG for experimental studies?

To generate specific antibodies against C. sakazakii glpG:

  • Antigen selection: Choose hydrophilic, surface-exposed regions of glpG based on structural predictions or alignments with known rhomboid protease structures. Alternatively, use purified full-length protein in detergent for immunization.

  • Peptide synthesis: For epitope-specific antibodies, synthesize peptides (15-20 amino acids) corresponding to selected regions, conjugate to carrier proteins (KLH or BSA).

  • Immunization protocol: Immunize rabbits or mice with the antigen using standard protocols with initial complete Freund's adjuvant followed by incomplete adjuvant boosters.

  • Antibody purification: Purify antibodies using protein A/G columns followed by affinity purification against the immunizing antigen.

  • Validation: Confirm specificity using Western blot against recombinant glpG and C. sakazakii lysates. Include controls with glpG knockout strains to verify specificity.

  • Cross-reactivity testing: Test against related proteins from other Cronobacter species and enterobacteria to ensure specificity, as C. sakazakii shares genetic similarities with other species in the genus .

How should researchers analyze kinetic data from C. sakazakii glpG enzymatic assays?

Analysis of kinetic data from C. sakazakii glpG enzymatic assays should follow these methodological steps:

  • Michaelis-Menten kinetics: Calculate Km and Vmax using non-linear regression of initial velocity data collected at various substrate concentrations. For membrane proteins like glpG, account for detergent effects on substrate presentation.

  • Inhibition studies: Use competitive, non-competitive, and uncompetitive inhibition models to analyze inhibitor effects. Calculate Ki values through appropriate plot transformations (Lineweaver-Burk, Dixon, or Cornish-Bowden).

  • Temperature and pH dependence: Analyze activity across temperature and pH ranges using Arrhenius plots for temperature and bell-shaped curves for pH. Consider that C. sakazakii shows significant differences in growth at various temperatures , which may reflect enzymatic activity patterns.

  • Statistical validation: Apply appropriate statistical tests (ANOVA, t-tests) when comparing wild-type versus mutant enzymes or different experimental conditions.

  • Model comparison: Use Akaike Information Criterion (AIC) or similar approaches to compare different kinetic models and determine the best fit.

For complex datasets, utilize computational modeling tools that can account for the topological constraints and folding characteristics of glpG that might influence its enzymatic behavior.

What are the key controls needed when studying glpG function in C. sakazakii virulence models?

When studying glpG function in C. sakazakii virulence models, researchers should implement these essential controls:

  • Genetic complementation: Include glpG knockout strains complemented with wild-type glpG to confirm phenotypes are specifically due to glpG deletion rather than polar effects or secondary mutations.

  • Catalytic mutants: Compare wild-type glpG with catalytically inactive mutants (e.g., serine to alanine mutations in the active site) to distinguish between proteolytic and potential non-enzymatic functions.

  • Growth rate normalization: Account for potential differences in bacterial growth rates between wild-type and mutant strains, especially under different temperature conditions as C. sakazakii growth rates vary significantly with temperature .

  • Host cell controls: In infection models, include uninfected cells and cells infected with non-pathogenic bacteria to control for host cell responses.

  • Strain verification: Verify strain identity through molecular typing methods, as C. sakazakii has multiple serotypes with varying virulence potential .

  • Antibiotic resistance: Monitor for potential antibiotic resistance, as C. sakazakii strains increasingly show resistance to multiple antibiotics , which could confound experimental results when using antibiotic selection.

How does C. sakazakii glpG compare structurally and functionally to rhomboid proteases in other bacteria?

C. sakazakii glpG belongs to the widely conserved family of rhomboid intramembrane proteases but may possess unique structural and functional adaptations:

FeatureC. sakazakii glpGE. coli GlpGOther bacterial rhomboids
Transmembrane domainsLikely 6 core TM domains6 TM domainsTypically 6-7 TM domains
Catalytic residuesConserved Ser-His dyadSer-His dyadSer-His dyad
Folding characteristicsInvolves topological constraints and modular structure Well-characterized folding with similar constraintsVariable depending on species
Environmental adaptationsPotentially adapted for stress survival in arid conditions General housekeeping functionsSpecies-specific adaptations
Substrate specificityNot fully characterizedCleaves specific TM substratesVaries by species and ecological niche

The topological constraints in glpG folding observed in studies may have functional significance, as mutations that destabilize thermodynamics can accelerate folding in detergent micelles . This characteristic could potentially relate to C. sakazakii's remarkable environmental stress tolerance compared to other enterobacteria.

What genetic variations exist in glpG across different C. sakazakii strains and how might they impact function?

Genetic variations in glpG across different C. sakazakii strains may significantly impact function and could correlate with strain-specific virulence or stress tolerance:

  • Sequence polymorphisms: SNPs in the glpG coding region may alter protein structure, substrate recognition, or catalytic efficiency. Analysis should focus on variations in the catalytic domain and substrate-binding regions.

  • Expression differences: Promoter variations could affect glpG expression levels under different conditions, potentially correlating with the seven O-antigen RFLP patterns identified in Cronobacter species .

  • Strain-specific adaptations: Variations may correlate with strain-specific ecological niches or virulence potential, particularly in strains like ST-4 or clonal complex 4 (CC4) known for higher virulence in infants .

To investigate these variations, researchers should:

  • Sequence glpG from multiple clinical and environmental isolates

  • Correlate sequence variations with phenotypic differences in stress tolerance or virulence

  • Perform phylogenetic analysis to understand evolutionary relationships

  • Use complementation studies with variant glpG alleles to assess functional differences

What emerging technologies could advance our understanding of C. sakazakii glpG structure and function?

Several emerging technologies offer promising avenues for advancing our understanding of C. sakazakii glpG:

  • Cryo-electron microscopy: Enables high-resolution structural determination of membrane proteins without crystallization, particularly valuable for understanding the topological constraints in glpG folding .

  • Native mass spectrometry: Allows analysis of intact membrane protein complexes, helping identify glpG interaction partners and substrates in their native state.

  • Single-molecule enzymology: Provides insights into the dynamics of individual glpG molecules during substrate recognition and cleavage, revealing heterogeneity masked in bulk assays.

  • Nanodiscs technology: Enables study of glpG in a more native-like lipid environment compared to detergent micelles, potentially revealing functionally relevant conformations.

  • CRISPR-Cas genome editing: Facilitates precise genetic manipulation of C. sakazakii to study glpG function in vivo with minimal off-target effects.

  • AlphaFold and similar AI structure prediction tools: Can predict glpG structures with increasing accuracy, helpful for regions difficult to resolve experimentally.

  • Single-cell approaches: May reveal heterogeneity in glpG expression and function across bacterial populations, particularly relevant given the variable lag times observed in C. sakazakii populations .

How might understanding C. sakazakii glpG function contribute to developing novel antimicrobial strategies?

Understanding C. sakazakii glpG function could contribute to novel antimicrobial strategies through several approaches:

  • Targeted inhibitors: Development of specific glpG inhibitors that disrupt membrane protein regulation in C. sakazakii, potentially compromising bacterial stress response. This approach is particularly valuable given the increasing antibiotic resistance observed in C. sakazakii strains .

  • Virulence attenuation: If glpG plays a role in virulence factor processing or regulation, inhibitors could reduce pathogenicity without killing bacteria, potentially reducing selection pressure for resistance.

  • Combination therapies: GlpG inhibitors could be used alongside conventional antibiotics to enhance efficacy, particularly against antibiotic-resistant strains carrying resistance genes like ampC, fosA, gyrA, gyrB, parC and parB .

  • Biofilm disruption: If glpG functions in biofilm formation or maintenance, targeting it could enhance the effectiveness of disinfection strategies in food production environments.

  • Cross-species applications: Insights from C. sakazakii glpG may apply to related pathogens within the Cronobacter genus and beyond, potentially leading to broad-spectrum approaches.

Research in this direction should focus on identifying unique structural or functional features of C. sakazakii glpG that distinguish it from human rhomboid proteases to ensure therapeutic specificity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.