Recombinant Cronobacter sakazakii Spermidine export protein MdtJ (mdtJ)

Shipped with Ice Packs
In Stock

Description

Protein Overview

MdtJ belongs to the small multidrug resistance (SMR) family of transporters, typically forming heterodimers (e.g., MdtJI in E. coli) to export toxic compounds like spermidine . In Cronobacter sakazakii, computational homology modeling suggests MdtJ shares >60% sequence similarity with E. coli MdtJ, featuring four transmembrane helices and conserved residues critical for substrate binding . Recombinant versions are expressed in E. coli with N-terminal His tags for purification .

Functional Role in Spermidine Homeostasis

MdtJ complexes mitigate spermidine toxicity by exporting excess intracellular polyamines:

  • E. coli MdtJI: Reduces spermidine concentration by 65% under 2 mM spermidine stress, restoring cell viability .

  • pH Dependency: Functions optimally at neutral pH, unlike other polyamine exporters (e.g., PotE) .

  • Gene Regulation: mdtJI expression is upregulated during spermidine overaccumulation .

In Cronobacter sakazakii, spermidine export may enhance survival in nutrient-rich environments (e.g., infant formula), though direct evidence remains hypothetical .

4.1. Excretion Activity

  • E. coli: MdtJI overexpression decreases intracellular spermidine from 1,200 nmol/mg to 400 nmol/mg .

  • Y. pseudotuberculosis: Recombinant MdtJ (B2K336) retains 90% activity after lyophilization .

  • S. typhi: MdtJ exports spermidine at a rate of 12 nmol/min/mg protein .

4.2. Pathogenicity Links

While Cronobacter MdtJ is uncharacterized, polyamine transport systems in the pathogen correlate with virulence:

  • Iron acquisition genes (e.g., iucABD) enhance survival in host blood .

  • Outer membrane proteins (OmpA/X) facilitate blood-brain barrier penetration .

Recombinant Production Protocols

ParameterSpecificationSource
Expression HostE. coli BL21(DE3)
Purification MethodNi-NTA affinity chromatography
Purity>90% (SDS-PAGE)
Storage-80°C in Tris/PBS + 6% trehalose

Knowledge Gaps and Future Directions

  • Cronobacter-Specific Data: No direct studies confirm MdtJ’s role in C. sakazakii.

  • Therapeutic Potential: MdtJ inhibitors could reduce bacterial load in neonatal infections .

  • Structural Biology: Cryo-EM studies are needed to resolve Cronobacter MdtJ’s binding pocket.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare according to your specifications.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us, and we will prioritize development according to your specifications.
Synonyms
mdtJ; ESA_01729; Spermidine export protein MdtJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)
Target Names
mdtJ
Target Protein Sequence
MIYWILLALAIVSEITGTLALKWASVGGGHAGFILMLVMISLSYILLSFSVKRIALGVAY ALWEGVGIVLITLFSVLLFNETLTVQKALGLLVLIAGILLIKTGTRTVSRKAEVRHVAG
Uniprot No.

Target Background

Function
Catalyzes the excretion of spermidine.
Database Links
Protein Families
Small multidrug resistance (SMR) protein family, MdtJ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is MdtJ and what is its primary function in Cronobacter sakazakii?

MdtJ is a protein belonging to the small multidrug resistance (SMR) family of drug exporters in Cronobacter sakazakii. It functions primarily as part of a spermidine excretion protein complex (MdtJI) that regulates intracellular polyamine levels. The MdtJI complex specifically catalyzes the excretion of spermidine from cells, which is crucial for maintaining cellular homeostasis and preventing spermidine toxicity. This transport system is essential for C. sakazakii's survival in various environments, particularly when exposed to high spermidine concentrations that could otherwise be toxic to the bacterium .

How does MdtJ relate to Cronobacter sakazakii pathogenicity?

Cronobacter sakazakii is an opportunistic bacterial pathogen that causes severe neonatal and pediatric infections including meningitis, necrotizing enterocolitis, and bacteremia, with approximately 50% mortality rate in infected infants . MdtJ, as part of the MdtJI complex, contributes to C. sakazakii's pathogenicity by enabling the bacterium to regulate intracellular polyamine levels, which is critical for its survival within the host. This efflux system represents one of the mechanisms allowing C. sakazakii to adapt to diverse ecological niches, including the human host environment. The protein's role in spermidine excretion may help the pathogen maintain cellular functions during infection, potentially contributing to its virulence and survival capacity .

What is the genetic context of mdtJ in the Cronobacter sakazakii genome?

The mdtJ gene is part of the C. sakazakii pan-genome, which contains approximately 17,158 orthologous gene clusters. The core genome, which includes genes present in all strains, constitutes about 19.5% of the pan-genome . The mdtJ gene is typically present alongside mdtI, as both are necessary to form the functional MdtJI complex. Research indicates that the expression of both mdtJ and mdtI is regulated in response to environmental conditions, particularly spermidine levels. The level of mdtJI mRNA increases when cells are exposed to spermidine, suggesting a specific regulatory mechanism in response to polyamine stress .

Which specific amino acid residues are critical for MdtJ function, and how were they identified?

Research has identified several key amino acid residues in MdtJ that are crucial for its spermidine excretion activity. These include Tyr 4, Trp 5, Glu 15, Tyr 45, Tyr 61, and Glu 82 . These residues were identified through systematic mutational analysis and functional studies examining how alterations at these positions affected spermidine excretion efficiency.

In a complementary manner, the partner protein MdtI contains critical residues at positions Glu 5, Glu 19, Asp 60, Trp 68, and Trp 81 that are similarly essential for the excretion activity of the MdtJI complex . The experimental approach typically involves site-directed mutagenesis of these residues, followed by functional assays measuring the cells' ability to excrete spermidine and resist spermidine toxicity. The predominance of aromatic and negatively charged residues suggests a specific mechanism for recognizing and transporting the positively charged spermidine molecule.

How does the MdtJI complex function mechanistically to export spermidine?

The MdtJI complex functions as a heterodimeric transporter that facilitates the excretion of spermidine from the bacterial cell. Mechanistically, the complex appears to utilize a proton motive force-dependent mechanism, which is common among SMR family transporters .

The specificity for spermidine is conferred by the arrangement of critical amino acid residues that form a binding pocket with appropriate electrostatic and spatial properties. The negatively charged residues (Glu and Asp) likely interact with the positively charged amine groups of spermidine, while aromatic residues (Tyr and Trp) may form cation-π interactions with the polyamine . The transport process involves:

  • Recognition and binding of intracellular spermidine

  • Conformational change in the MdtJI complex

  • Release of spermidine to the extracellular environment

  • Return to the initial state, potentially coupled with proton translocation

This process effectively regulates intracellular spermidine levels, preventing toxic accumulation while maintaining sufficient amounts for normal cellular functions.

What expression systems are most effective for producing recombinant Cronobacter sakazakii MdtJ protein?

For recombinant expression of Cronobacter sakazakii MdtJ, E. coli-based expression systems have proven effective. Based on the research data, several expression vector systems have been successfully employed:

  • pUC-based vectors: The pUC mdtJI plasmid has demonstrated high-level expression that effectively rescues E. coli cells from spermidine toxicity .

  • Low-copy pMW vectors: The pMW mdtJI expression system provides more moderate expression, which may be beneficial for functional studies requiring physiological protein levels .

  • Tagged expression systems: Vectors incorporating epitope tags such as HA₃ (e.g., pUC mdtJ-HA₃) facilitate protein detection and purification while maintaining functionality .

For optimal expression, researchers should consider:

  • Using E. coli strains deficient in endogenous polyamine transport systems to avoid background activity

  • Incorporating the native promoter region to maintain natural regulation patterns

  • Co-expressing both mdtJ and mdtI genes, as both are required for functional activity

  • Optimizing growth conditions, including temperature and induction timing, to maximize protein yield while maintaining proper folding

The choice between high-copy (pUC) and low-copy (pMW) vectors should be based on the specific experimental goals, with high-copy vectors providing greater protein yield but potentially causing cellular stress due to overexpression.

What functional assays can be used to evaluate MdtJ activity in laboratory settings?

Several functional assays have been effectively used to evaluate MdtJ activity:

Spermidine Toxicity Rescue Assay

  • Transform cells deficient in spermidine acetyltransferase (which are sensitive to spermidine) with mdtJI-expressing plasmids

  • Culture cells in media containing high spermidine concentrations (e.g., 12 mM)

  • Measure growth rates to assess recovery from spermidine toxicity

  • This assay provides a clear phenotypic readout of functional MdtJI complex activity

Spermidine Content Measurement

  • Culture cells in media with defined spermidine concentration (e.g., 2 mM)

  • Extract cellular polyamines using standardized protocols

  • Quantify intracellular spermidine levels using HPLC or LC-MS methods

  • Compare spermidine content between cells with and without MdtJI expression

Spermidine Excretion Assay

  • Preload cells with labeled spermidine (radioisotope or fluorescent)

  • Measure the rate of labeled spermidine appearance in the culture medium

  • Calculate excretion rates in the presence and absence of MdtJI expression

  • This direct measurement of transport activity provides kinetic parameters of the transporter

Site-Directed Mutagenesis Analysis

  • Generate mutations in key residues (e.g., Tyr 4, Trp 5, Glu 15, Tyr 45, Tyr 61, and Glu 82 in MdtJ)

  • Test mutant proteins in any of the above assays

  • Identify amino acids essential for transporter function

  • This approach helps elucidate structure-function relationships

Each of these assays provides complementary information about MdtJ function, and combining multiple approaches offers the most comprehensive characterization of the protein's activity.

How does spermidine excretion through MdtJ contribute to Cronobacter sakazakii survival in different environments?

Spermidine excretion via the MdtJI complex plays a crucial role in C. sakazakii's survival across diverse environmental niches:

  • Polyamine Homeostasis Regulation: The MdtJI system helps maintain optimal intracellular spermidine levels. When environmental spermidine levels are high, the expression of mdtJI increases, enhancing the cell's capacity to excrete excess spermidine and prevent toxicity . This regulatory mechanism is essential for adaptation to polyamine-rich environments.

  • Stress Response: Polyamines including spermidine are involved in bacterial stress responses. By regulating spermidine levels, MdtJI may help C. sakazakii adapt to various stressors, including osmotic stress, oxidative stress, and antimicrobial compounds.

  • Environmental Persistence: C. sakazakii is known for its remarkable ability to survive in extreme environments, including dry and nutrient-poor conditions. The MdtJI system may contribute to this persistence by helping maintain cellular homeostasis under stress conditions .

  • Host Colonization: During infection, bacteria encounter various host defense mechanisms, including potentially toxic levels of polyamines. The MdtJI system likely helps C. sakazakii adapt to the host environment by managing polyamine levels, contributing to its success as an opportunistic pathogen .

  • Ecological Niche Adaptation: The pan-genome analysis of C. sakazakii reveals its ability to switch between ecological niches, which partly explains its remarkable adaptability . The MdtJI system may facilitate this ecological flexibility by providing a mechanism to respond to varying polyamine levels in different environments.

What is the relationship between MdtJ and other multidrug resistance transporters in Cronobacter sakazakii?

MdtJ belongs to the small multidrug resistance (SMR) family of transporters and functions as part of the bacterial defense system against potentially toxic compounds. The relationship between MdtJ and other multidrug resistance transporters in C. sakazakii can be characterized as follows:

  • Functional Complementarity: While MdtJ specifically partners with MdtI to form a spermidine export complex, C. sakazakii possesses numerous other multidrug resistance transporters, including mdf(A), which was found in nearly all C. sakazakii genomes . These transporters likely have overlapping but distinct substrate specificities, collectively providing protection against a wide range of toxic compounds.

  • Evolutionary Relationships: The frequent recombination detected in the C. sakazakii pan-genome (affecting 53.3% of the genome) suggests that genes encoding multidrug transporters may be subject to horizontal gene transfer and recombination events . This genetic mobility may allow for rapid adaptation to new environmental challenges and acquisition of new resistance mechanisms.

  • Regulatory Networks: Different transporter systems likely respond to distinct signals but may also share regulatory pathways. For instance, the expression of mdtJI increases in response to spermidine , suggesting specific regulation, but there may also be global regulators that coordinate expression of multiple transporter systems in response to general stress conditions.

  • Substrate Overlap: While MdtJ specifically contributes to spermidine export, many multidrug transporters have broad substrate specificities. Some overlap in substrate recognition may exist between MdtJ and other transporters, providing redundancy in cellular defense systems.

  • Structural Similarities: As a member of the SMR family, MdtJ shares structural features with other SMR transporters in C. sakazakii. These similarities may reflect common mechanisms of substrate recognition and transport, while specific residues determine substrate preferences.

How can recombinant MdtJ be utilized to study antimicrobial resistance mechanisms in Cronobacter sakazakii?

Recombinant MdtJ provides a valuable tool for investigating antimicrobial resistance mechanisms in C. sakazakii through several sophisticated approaches:

  • Structure-Guided Inhibitor Design:

    • Express and purify recombinant MdtJ for structural studies (crystallography or cryo-EM)

    • Identify binding pockets and critical residues involved in transport

    • Design small molecule inhibitors that specifically target MdtJ

    • Validate inhibitors as potential adjuvants to enhance antibiotic efficacy against C. sakazakii

  • Resistance Mechanism Characterization:

    • Use site-directed mutagenesis to create MdtJ variants mimicking naturally occurring polymorphisms

    • Assess how these variants affect spermidine export and resistance to antimicrobial compounds

    • Correlate specific mutations with changes in resistance profiles

    • This approach can reveal how MdtJ contributes to the emerging antibiotic-resistant strains of C. sakazakii

  • Transport Kinetics Analysis:

    • Reconstitute purified recombinant MdtJ into liposomes or nanodiscs

    • Measure transport kinetics of various substrates, including antibiotics

    • Determine if MdtJ-mediated export contributes to resistance against specific antimicrobial agents

    • Such studies would provide quantitative parameters (Km, Vmax) for MdtJ-mediated transport

  • Combination Therapy Development:

    • Screen for compounds that modulate MdtJ activity (inhibitors or enhancers)

    • Test these modulators in combination with conventional antibiotics

    • Identify synergistic combinations that overcome resistance

    • This approach could lead to new therapeutic strategies against resistant C. sakazakii strains

  • Cross-Resistance Analysis:

    • Express recombinant MdtJ in susceptible bacterial strains

    • Test whether MdtJ expression confers resistance to various classes of antibiotics

    • Map the spectrum of cross-resistance provided by MdtJ

    • Results would illuminate MdtJ's role in the broader context of multidrug resistance

These approaches collectively provide a comprehensive framework for understanding how MdtJ contributes to antimicrobial resistance in C. sakazakii, potentially leading to new strategies for combating this pathogen.

What techniques can be used to study the interaction between MdtJ and MdtI at the molecular level?

Investigating the molecular interactions between MdtJ and MdtI requires sophisticated biophysical and biochemical techniques:

  • Co-Immunoprecipitation (Co-IP):

    • Express tagged versions of MdtJ (e.g., MdtJ-HA₃) and MdtI in bacterial cells

    • Lyse cells and immunoprecipitate using antibodies against the tag

    • Analyze precipitated proteins by Western blotting to confirm co-precipitation

    • This approach confirms physical interaction in cellular context

  • Förster Resonance Energy Transfer (FRET):

    • Create fusion proteins linking MdtJ and MdtI to appropriate fluorophores (e.g., CFP and YFP)

    • Express these constructs in cells or reconstitute in membrane mimetics

    • Measure energy transfer efficiency to detect proximity (<10 nm)

    • FRET can reveal dynamic interactions and conformational changes during transport

  • Cross-linking Mass Spectrometry:

    • Treat purified MdtJ-MdtI complex with chemical cross-linkers

    • Digest the cross-linked complex and analyze by mass spectrometry

    • Identify cross-linked peptides to map interaction interfaces

    • This technique provides detailed information about specific residues involved in the interaction

  • Cryo-Electron Microscopy:

    • Purify the MdtJ-MdtI complex in detergent micelles or nanodiscs

    • Apply the sample to cryo-EM grids and collect high-resolution images

    • Process data to generate 3D structural models

    • Cryo-EM can reveal the complete structure of the complex at near-atomic resolution

  • Site-Directed Mutagenesis Combined with Functional Assays:

    • Create mutations at predicted interface residues in both MdtJ and MdtI

    • Assess how mutations affect complex formation and function

    • Identify residues critical for protein-protein interaction

    • This approach has already identified key functional residues in both proteins (e.g., Tyr 4, Trp 5, Glu 15, Tyr 45, Tyr 61, and Glu 82 in MdtJ)

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Compare deuterium uptake patterns of individual proteins versus the complex

    • Regions with altered exchange rates in the complex indicate interaction interfaces

    • This technique is particularly valuable for membrane proteins like MdtJ and MdtI

These complementary approaches provide a comprehensive understanding of how MdtJ and MdtI interact to form a functional spermidine export complex, offering insights into their cooperative mechanism of action.

How has the mdtJ gene evolved across Cronobacter species and related Enterobacteriaceae?

The evolution of the mdtJ gene across Cronobacter species and related Enterobacteriaceae reflects the broader evolutionary dynamics of these bacterial genomes:

This evolutionary perspective provides important context for understanding the role of MdtJ in bacterial physiology and its potential as a target for antimicrobial development.

What are the optimized protocols for purifying active recombinant MdtJ protein for structural studies?

Purifying active recombinant MdtJ protein for structural studies requires careful attention to several critical factors:

Table 1: Recommended Expression Systems for MdtJ Purification

Expression SystemVectorHost StrainAdvantagesLimitations
E. coli BL21(DE3)pET with C-terminal His-tagC43(DE3)Membrane protein-friendly strainMay require codon optimization
E. coli BL21(DE3)pMW119 with dual His/HA tagsCAG2242Demonstrated for functional MdtJ Lower expression levels
Insect cellsBaculovirus vectorSf9 or Hi5Better folding of complex proteinsHigher cost, longer timeframe
Cell-freeLinear DNA templatesCommercial lysatesRapid screening of conditionsLower yield for membrane proteins

Purification Protocol:

  • Expression Optimization

    • Induce at OD600 = 0.6-0.8 with 0.1-0.5 mM IPTG

    • Grow at lower temperature (18-25°C) after induction

    • Co-express with MdtI for improved stability

    • Add 5-10% glycerol to growth media to stabilize membrane proteins

  • Membrane Isolation

    • Harvest cells and resuspend in buffer containing:

      • 50 mM Tris-HCl pH 7.5

      • 150 mM NaCl

      • 10% glycerol

      • Protease inhibitor cocktail

    • Disrupt cells by sonication or high-pressure homogenization

    • Remove cell debris by centrifugation (10,000 × g, 20 min)

    • Isolate membranes by ultracentrifugation (100,000 × g, 1 h)

  • Detergent Solubilization

    • Resuspend membrane fraction in solubilization buffer:

      • 50 mM Tris-HCl pH 7.5

      • 150 mM NaCl

      • 10% glycerol

      • 1-2% detergent (test DDM, LMNG, or DMNG)

    • Incubate with gentle agitation for 1-2 h at 4°C

    • Remove insoluble material by ultracentrifugation (100,000 × g, 30 min)

  • Affinity Purification

    • Apply solubilized protein to Ni-NTA or anti-HA affinity resin

    • Wash with 20-50 mM imidazole to remove non-specific binding

    • Elute with 250-300 mM imidazole or HA peptide

    • Consider tandem affinity purification if using dual tags

  • Size Exclusion Chromatography

    • Further purify by gel filtration using Superdex 200

    • Buffer: 25 mM Tris-HCl pH 7.5, 150 mM NaCl, 5% glycerol, 0.03-0.05% detergent

    • Collect fractions corresponding to the expected size of the MdtJ-MdtI complex

  • Reconstitution Options for Structural Studies

    • Lipid nanodiscs with MSP1D1 scaffold protein

    • Amphipols (A8-35) for cryo-EM studies

    • Lipidic cubic phase for crystallization trials

    • Liposome reconstitution for functional assays

  • Quality Control Assessments

    • SDS-PAGE and Western blot to confirm purity and identity

    • Dynamic light scattering to assess homogeneity

    • Circular dichroism to confirm secondary structure

    • Functional assay (e.g., spermidine binding or transport) to verify activity

This optimized protocol should yield pure, active MdtJ protein suitable for structural studies using X-ray crystallography, cryo-EM, or NMR spectroscopy, depending on the specific reconstitution method chosen.

What CRISPR-Cas9 strategies can be employed to study mdtJ function in Cronobacter sakazakii?

CRISPR-Cas9 technology offers powerful approaches to investigate mdtJ function in Cronobacter sakazakii:

  • Gene Knockout Strategy

    • Design sgRNAs targeting the coding region of mdtJ

    • Create a suicide vector containing the Cas9 gene, sgRNA expression cassette, and homology arms

    • Transform C. sakazakii and select for successful integration

    • Verify knockout by PCR and sequencing

    • Assess phenotypic changes in:

      • Spermidine tolerance

      • Growth in various environmental conditions

      • Virulence in infection models

      • Antibiotic susceptibility profiles

  • Precision Gene Editing

    • Design sgRNAs targeting specific regions of mdtJ

    • Include repair templates with desired mutations in key residues (e.g., Tyr 4, Trp 5, Glu 15, Tyr 45, Tyr 61, and Glu 82)

    • Generate a library of strains with different point mutations

    • Conduct functional analysis to correlate specific residues with functional outcomes

  • Promoter Modification

    • Target the mdtJ promoter region with CRISPR-Cas9

    • Introduce constitutive promoters or inducible expression systems

    • Study the effect of altered mdtJ expression levels on cellular physiology

    • Determine how expression regulation affects spermidine tolerance and related phenotypes

  • CRISPRi for Conditional Knockdown

    • Use catalytically inactive Cas9 (dCas9) fused to a repressor domain

    • Design sgRNAs targeting the mdtJ promoter or early coding region

    • Create an inducible CRISPRi system to control the timing of gene repression

    • Study the immediate consequences of mdtJ repression without complete gene deletion

  • CRISPRa for Overexpression Studies

    • Employ dCas9 fused to transcriptional activators

    • Target the mdtJ promoter to enhance expression

    • Investigate the effects of mdtJ overexpression on polyamine homeostasis

    • Determine if increased expression affects resistance to antibiotics or environmental stressors

  • Multiplex CRISPR for Pathway Analysis

    • Simultaneously target mdtJ and related genes (e.g., mdtI and other polyamine metabolism genes)

    • Generate double or triple mutants

    • Examine genetic interactions and potential compensatory mechanisms

    • Identify synthetic lethal combinations that could inform antimicrobial development

  • Base Editing Applications

    • Use CRISPR base editors to create precise C→T or A→G substitutions

    • Introduce silent mutations to study codon usage effects

    • Create specific amino acid changes without double-strand breaks

    • Reduce off-target effects compared to traditional CRISPR-Cas9

These CRISPR-based approaches provide versatile tools for comprehensive functional analysis of mdtJ in C. sakazakii, offering insights into its role in bacterial physiology, pathogenicity, and potential as an antimicrobial target.

What are the most promising research directions for understanding MdtJ's role in Cronobacter sakazakii pathogenesis?

The study of MdtJ in Cronobacter sakazakii pathogenesis presents several promising research directions:

  • Host-Pathogen Interaction Studies

    • Investigate how MdtJ-mediated polyamine export affects C. sakazakii survival within host cells

    • Determine if MdtJ contributes to evasion of host immune responses

    • Examine whether host-derived polyamines induce mdtJ expression during infection

    • These studies would connect MdtJ function directly to pathogenesis mechanisms

  • Systems Biology Approaches

    • Apply transcriptomics to identify genes co-regulated with mdtJ under various conditions

    • Use proteomics to map the interaction network of MdtJ beyond its partnership with MdtI

    • Employ metabolomics to characterize how MdtJ affects the broader polyamine metabolome

    • Integrate multi-omics data to place MdtJ in the context of global cellular responses

  • Evolutionary and Epidemiological Analysis

    • Compare mdtJ sequences across clinical and environmental isolates of C. sakazakii

    • Correlate specific mdtJ variants with virulence, focusing on the ten deep branching monophyletic lineages identified in C. sakazakii

    • Investigate whether mdtJ sequence or expression varies between isolates from different disease presentations

    • This approach could identify pathogenicity-associated mdtJ variants

  • Therapeutic Target Development

    • Design and screen for specific inhibitors of the MdtJI complex

    • Test inhibitor efficacy in reducing C. sakazakii virulence in cell culture and animal models

    • Develop combination therapies targeting MdtJ alongside conventional antibiotics

    • Evaluate the potential for resistance development against MdtJ-targeted therapies

  • Biofilm Formation and Persistence

    • Examine the role of MdtJ in biofilm formation and maintenance

    • Investigate whether polyamine export via MdtJ contributes to C. sakazakii persistence in environmental reservoirs

    • Determine if targeting MdtJ can disrupt established biofilms, particularly in food production environments

    • This direction connects MdtJ function to the bacterium's remarkable environmental persistence

These research directions collectively represent a comprehensive approach to understanding MdtJ's role in C. sakazakii pathogenesis, potentially leading to new strategies for controlling this significant neonatal pathogen and reducing its approximately 50% mortality rate in infected infants .

How might technological advances in structural biology impact our understanding of MdtJ function and inhibitor design?

Recent and emerging advances in structural biology offer unprecedented opportunities to understand MdtJ function and develop targeted inhibitors:

  • Cryo-Electron Microscopy Advancements

    • Single-particle cryo-EM now routinely achieves sub-3Å resolution for membrane proteins

    • Time-resolved cryo-EM can potentially capture different conformational states of the MdtJI complex during transport

    • Advances in sample preparation (e.g., graphene supports) improve resolution for smaller membrane proteins

    • These techniques could reveal the complete structure of MdtJI, including the spermidine binding site and conformational changes during transport

  • Integrated Structural Biology Approaches

    • Combining X-ray crystallography, cryo-EM, NMR, and molecular dynamics simulations

    • Each method provides complementary information about structure and dynamics

    • Hybrid approaches overcome limitations of individual techniques

    • This integration would provide a comprehensive understanding of MdtJ structure-function relationships

  • AI-Powered Structure Prediction

    • AlphaFold2 and similar AI tools can predict protein structures with impressive accuracy

    • These predictions can guide experimental design and interpretation

    • For membrane proteins like MdtJ, AI models continue to improve in accuracy

    • Predicted structures can accelerate research by providing working models before experimental structures are available

  • Structure-Based Drug Design

    • High-resolution structures enable rational design of MdtJ inhibitors

    • Virtual screening of compound libraries against structural models

    • Fragment-based drug discovery approaches to identify initial scaffolds

    • These approaches could yield specific inhibitors that block spermidine transport without affecting host transporters

  • Membrane Mimetic Technologies

    • Advanced nanodiscs with covalently circularized scaffold proteins

    • Styrene maleic acid lipid particles (SMALPs) that extract membrane proteins with their native lipid environment

    • Cell-free expression directly into nanodiscs or liposomes

    • These technologies provide more native-like environments for structural studies of MdtJ

  • In-Cell Structural Biology

    • Cellular cryo-electron tomography to visualize MdtJ in its native cellular context

    • In-cell NMR to study dynamics and interactions within living bacteria

    • These approaches bridge the gap between isolated protein studies and cellular function

The implementation of these advanced technologies would transform our understanding of MdtJ's molecular mechanism, enabling structure-guided development of inhibitors that could serve as novel antimicrobials or potentiators of existing antibiotics against Cronobacter sakazakii.

What key methodologies should be included in a comprehensive research program investigating MdtJ in Cronobacter sakazakii?

A comprehensive research program investigating MdtJ in Cronobacter sakazakii should incorporate these key methodologies:

Table 2: Core Methodologies for MdtJ Research

Research AreaMethodologyPurposeTechnical Considerations
Genetic AnalysisCRISPR-Cas9 genome editingGenerate precise gene knockouts and mutationsDesign sgRNAs with minimal off-target effects
Expression AnalysisRT-qPCR and RNA-SeqQuantify mdtJ expression under various conditionsInclude appropriate reference genes for normalization
Protein ProductionRecombinant expression in E. coliGenerate protein for biochemical and structural studiesCo-express with MdtI for optimal stability
Protein PurificationDetergent solubilization and affinity chromatographyObtain pure protein for biophysical studiesScreen multiple detergents for optimal extraction
Structural AnalysisCryo-EM and X-ray crystallographyDetermine MdtJ structure at atomic resolutionConsider lipid nanodisc reconstitution
Functional AssaysSpermidine toxicity rescueMeasure in vivo activity of MdtJ variantsUse C. sakazakii or E. coli CAG2242 strain
Transport StudiesRadioisotope or fluorescent substrate trackingQuantify transport kineticsEstablish reliable baselines and controls
Interaction AnalysisCo-immunoprecipitation and crosslinking MSIdentify protein-protein interactionsDesign constructs with appropriate tags
Cell BiologyFluorescence microscopyDetermine subcellular localizationCreate functional fluorescent fusion proteins
Pathogenesis StudiesInfection modelsEvaluate role in virulenceConsider tissue culture and animal models
Inhibitor ScreeningHigh-throughput assaysIdentify potential therapeutic compoundsDevelop robust activity readouts
Computational AnalysisMolecular dynamics simulationsModel dynamic behavior and substrate interactionsUse appropriate membrane mimetics in simulations

Implementation of these methodologies would create a robust framework for comprehensive investigation of MdtJ, from basic biochemical characterization to potential therapeutic applications. The integration of multiple approaches allows for cross-validation of findings and addresses the complexity of membrane protein biology in the context of bacterial pathogenesis.

What are the ethical considerations and biosafety requirements for working with Cronobacter sakazakii in MdtJ research?

Research involving Cronobacter sakazakii requires careful attention to ethical and biosafety considerations due to its status as an opportunistic pathogen with high mortality rates in vulnerable populations:

  • Biosafety Classification and Laboratory Requirements

    • C. sakazakii is typically handled at Biosafety Level 2 (BSL-2)

    • Laboratory requirements include:

      • Restricted access to the laboratory

      • Biohazard warning signs

      • Class II biological safety cabinets for aerosol-generating procedures

      • Appropriate personal protective equipment (lab coats, gloves, eye protection)

      • Handwashing facilities and proper waste decontamination

    • Work involving large volumes or high concentrations may require additional containment measures

  • Risk Assessment Considerations

    • Evaluate researcher immunity status and vulnerability

    • Consider potential routes of exposure specific to planned procedures

    • Assess risks of generating antibiotic-resistant or enhanced virulence strains

    • Implement additional safeguards for high-risk procedures

  • Responsible Research Practices

    • Maintain transparent documentation of all experiments

    • Implement safeguards against accidental release

    • Consider dual-use research implications when enhancing or modifying pathogenic traits

    • Follow institutional and national guidelines for pathogen research

  • Alternative Research Models

    • When appropriate, use attenuated laboratory strains

    • Consider non-pathogenic closely related species for preliminary studies

    • Employ recombinant systems in non-pathogenic hosts (e.g., laboratory E. coli strains)

    • Use computational models to reduce need for live pathogen experiments

  • Public Health Implications

    • Balance research goals with potential public health risks

    • Consider how research outcomes could impact vulnerable populations

    • Prioritize studies with clear translational potential to reduce C. sakazakii infections

    • Ensure research findings are responsibly communicated to relevant stakeholders

  • Research Ethics Review

    • Obtain appropriate institutional biosafety committee approval

    • For studies involving clinical isolates, ensure proper ethical review

    • Address data sharing and material transfer agreement requirements

    • Comply with international regulations regarding pathogen research

  • Training Requirements

    • Ensure all personnel are properly trained in biosafety procedures

    • Provide pathogen-specific training regarding C. sakazakii risks

    • Implement regular safety reviews and updates

    • Maintain emergency response protocols for potential exposures

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.