Recombinant Cronobacter sakazakii Sulfoxide reductase heme-binding subunit YedZ (yedZ)

Shipped with Ice Packs
In Stock

Description

Definition and Molecular Characterization

Recombinant Cronobacter sakazakii YedZ is a cloned version of the heme-binding subunit of sulfoxide reductase, encoded by the yedZ gene (locus: ESA_03642). This protein forms part of the YedYZ enzyme complex, which facilitates sulfoxide reduction and sulfite oxidation in gram-negative bacteria . Key features include:

  • Domain architecture: Flavocytochrome with heme-binding motifs.

  • Homology: Shares functional similarity with YedZ subunits in Escherichia coli and Klebsiella pneumoniae, which are implicated in sulfur metabolism .

Production and Purification

The recombinant YedZ protein is expressed in heterologous systems such as E. coli, yeast, or mammalian cells, achieving ≥85% purity via SDS-PAGE .

Applications and Research Implications

  1. Biochemical Studies: Used to elucidate sulfur metabolism pathways in C. sakazakii.

  2. Antimicrobial Targets: Potential drug target due to its role in bacterial resistance to host immune defenses .

  3. Industrial Enzymes: Engineered variants may aid in bioremediation of sulfite-rich environments.

Knowledge Gaps and Future Directions

  • Mechanistic Detail: The exact substrate specificity and catalytic mechanism in C. sakazakii remain uncharacterized.

  • Pathogenicity Link: Whether YedZ contributes to virulence (like YeiE in sulfite tolerance ) requires validation.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time estimates.
Note: All protein shipments include standard blue ice packs. If dry ice shipping is required, please communicate this in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
msrQ; ESA_03642; Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ; Flavocytochrome MsrQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)
Target Names
msrQ
Target Protein Sequence
MRLTAKQITWLKVALHLAAFLPLVWLFYAASQGLFRADPAKDIQHFTGRMALKLLLATLL VTPLTRLLKQPLLIRTRRLLGLWCFAWATLHLVSYSLLELGLSNLSLLGSELVSRPYLTL GIVSWLILLALALTSFQAAQRKLGRRWQTLHNFIYLVAILAPIHYLWSVKILSPQPVLYA LGAIVLLAWRYKKLRQWWRT
Uniprot No.

Target Background

Function
YedZ, the heme-binding subunit of MsrPQ, is an integral part of the MsrPQ system that repairs oxidized periplasmic proteins containing methionine sulfoxide residues (Met-O). This repair process utilizes respiratory chain electrons. Thus, MsrPQ safeguards these proteins from oxidative stress damage caused by reactive oxygen and chlorine species generated by host defense mechanisms. MsrPQ is essential for maintaining envelope integrity under bleach stress, rescuing a diverse range of structurally unrelated periplasmic proteins from methionine oxidation. MsrQ supplies electrons for reduction to the reductase catalytic subunit MsrP, utilizing the quinone pool of the respiratory chain.
Database Links
Protein Families
MsrQ family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.