Recombinant Cronobacter sakazakii Thiol:disulfide interchange protein DsbD (dsbD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format we have in stock, we are happy to accommodate your specific format requirements. Please indicate your preferred format in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of our proteins depends on various factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple use, aliquoting is recommended to minimize freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag preference, please inform us, and we will prioritize developing it accordingly.
Synonyms
dsbD; ESA_00148; Thiol:disulfide interchange protein DsbD; Protein-disulfide reductase; Disulfide reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-574
Protein Length
Full Length of Mature Protein
Species
Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)
Target Names
dsbD
Target Protein Sequence
SLFGQQNASQFVPADQAFAFDFQQQQHQLTLNWQIKPGYYLYRQQIRVTPANASVAPPAL PTGEPHEDEFFGKSEIYRDALSVPVTVEQAAPGATLSVTYQGCAEAGFCYPPETRTVPLS AVEPTESVKANAATPSAATGEQTRVNSDSPSATLPFSAFWALLIGIGVAFTPCVLPMYPL ISGIVLGGDKRLSTRRALLLAFIYVQGMALTYTALGLVVAAAGLQFQAALQSPWVLVTLS AVFVLLALSMFGLFTLQLPASLQTRLTLMSNRQRGGSPGGVFAMGAIAGLICSPCTTAPL SAILLYIAQSGNLWLGGGTLYLYALGMGLPLILVTVFGNRLLPKSGPWMEQVKTAFGFVI LALPVFLLERVLGEPWGVRLWSVLGVAFFGWAFVTSLNATRSWMRAVQIVLLGAAMICAR PLQDWVFGAPVAESQAHLAFTRIATVDDLDRALAQAKGKPVMLDLYADWCVACKEFEKYT FSAPEVQRALDGAVLLQADVTANSAADVALLKRLNVLGLPTIIFFDAQGNEIPNGRVTGF MDAPAFATHLHNRLR
Uniprot No.

Target Background

Function
DsbD is crucial for the formation of correct disulfide bonds in certain periplasmic proteins, including the assembly of periplasmic c-type cytochromes. It acts by transferring electrons from cytoplasmic thioredoxin to the periplasm, involving a cascade of disulfide bond formation and reduction steps.
Database Links
Protein Families
Thioredoxin family, DsbD subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does the DsbD protein interact with other components of the disulfide bond formation pathway?

DsbD typically functions in conjunction with other Dsb proteins in a coordinated electron transfer chain. Based on studies in related bacteria, DsbD receives electrons from cytoplasmic thioredoxin and transfers them to periplasmic proteins like DsbC (for disulfide isomerization) and DsbA (for disulfide oxidation). Research on DsbA in C. sakazakii has shown its importance in regulating biofilm formation and environmental stress tolerance . DsbD's electron transfer function maintains this system's redox balance, ensuring proper protein folding and bacterial envelope integrity.

What genomic and molecular characteristics define C. sakazakii DsbD?

While specific information about C. sakazakii DsbD's structure is not explicitly detailed in current research, genomic analyses of C. sakazakii strains indicate the presence of disulfide bond formation system genes. The average genome length of C. sakazakii is approximately 4,419 kb with a G+C content of around 57.4% . Thiol:disulfide interchange proteins typically contain conserved CXXC motifs essential for their redox function. In C. sakazakii, these proteins likely contribute to the pathogen's ability to persist in various environments and cause infection.

What are the optimal conditions for expressing recombinant C. sakazakii DsbD?

For successful expression of recombinant DsbD:

  • Expression system selection: Use E. coli BL21(DE3) or similar strains optimized for membrane protein expression.

  • Temperature optimization: Lower temperatures (16-25°C) during induction help prevent inclusion body formation.

  • Induction parameters: Use lower IPTG concentrations (0.1-0.5 mM) and longer induction times.

  • Buffer composition: Include reducing agents (e.g., DTT or β-mercaptoethanol) during purification to maintain protein stability.

  • Detergent selection: For membrane protein DsbD, mild detergents like DDM or LDAO are recommended for solubilization.

The expression should be validated through Western blotting and activity assays to confirm proper folding and function.

How can researchers effectively generate and validate DsbD knockout mutants in C. sakazakii?

A methodological approach to generating DsbD knockout mutants includes:

  • Homologous recombination: Replace the dsbD gene with an antibiotic resistance cassette.

  • CRISPR-Cas9 system: Design guide RNAs targeting the dsbD gene.

  • Confirmation methods:

    • PCR verification of gene deletion

    • RT-qPCR to confirm absence of transcript

    • Western blotting to verify protein absence

    • Complementation studies to confirm phenotype specificity

Validation should include extensive phenotypic testing of mutants compared to wild-type strains, examining stress resistance, biofilm formation, and virulence attributes .

What assays can be used to measure DsbD activity in vitro?

Several biochemical assays can effectively measure DsbD activity:

  • Insulin reduction assay: Monitoring the precipitation of reduced insulin at 650 nm over time.

  • Fluorescent substrate assays: Using redox-sensitive fluorescent proteins to track electron transfer.

  • DTNB reduction assay: Measuring the release of TNB at 412 nm when DsbD reduces DTNB.

  • Coupled enzyme assays: Linking DsbD activity to a reporter enzyme for colorimetric detection.

  • Redox potential measurements: Using redox-sensitive dyes or electrochemical methods.

Control experiments should include heat-inactivated protein and active site mutants (CXXC → AXXC) to validate specificity.

How does DsbD contribute to C. sakazakii virulence and pathogenicity?

Based on research with related proteins like DsbA, DsbD likely contributes significantly to C. sakazakii pathogenicity through:

  • Proper folding of virulence factors: C. sakazakii strains harbor multiple virulence genes including outer membrane proteins (ompA, ompX), zinc-containing metalloprotease (zpx), and plasminogen activator (cpa), all found in over 73% of clinical isolates . Many of these proteins require proper disulfide bond formation.

  • Enhanced environmental stress resistance: The disulfide bond formation pathway is crucial for resistance to heat, desiccation, acid, oxidative stress, and osmotic stress - all critical for survival during infection .

  • Cellular invasion capability: Studies with DsbA show its contribution to adhesion and invasion in Caco-2 cells and intracellular survival in RAW 264.7 macrophages . DsbD likely supports these functions by maintaining DsbA in its active form.

  • Biofilm formation regulation: Proper disulfide bond formation affects biofilm development, an important virulence trait allowing C. sakazakii to persist on surfaces and resist antimicrobial treatments .

What is the relationship between DsbD function and antibiotic resistance in C. sakazakii?

While direct evidence linking DsbD to antibiotic resistance is limited, several important connections can be inferred:

  • Membrane integrity: The disulfide bond formation pathway maintains proper folding of envelope proteins, affecting membrane permeability and potentially antibiotic entry.

  • Biofilm contribution: DsbD's role in biofilm formation indirectly contributes to antibiotic tolerance, as biofilms provide physical barriers against antimicrobials.

  • Stress response regulation: The overlap between stress response systems and antibiotic resistance mechanisms suggests DsbD may influence resistance through its effect on stress tolerance.

  • Horizontal gene transfer: Some multidrug-resistant (MDR) C. sakazakii isolates carry resistance genes on plasmids alongside virulence factors . The proper folding of plasmid-encoded proteins may depend on functional disulfide bond formation systems.

Table 1: Virulence gene distribution in C. sakazakii isolates

Virulence geneFunctionPrevalence in isolates
ompA, ompXOuter membrane proteins100% (15/15)
nanAKTSialic acid utilization93.3% (14/15)
iucABCDIron acquisition system100% (15/15)
zpxZinc-containing metalloprotease73.3% (11/15)
hlyIIIHemolysin III100% (15/15)
hhaHemolysin expression-modulating protein100% (15/15)
cusCibeB-homologous13.3% (2/15)
hfqRNA-binding protein100% (15/15)
cpaPlasminogen activator80.0% (12/15)

Data adapted from genomic analysis of C. sakazakii isolates

How can structural analysis of DsbD inform inhibitor design for antimicrobial development?

Structure-based drug design targeting DsbD requires:

  • Structural determination: X-ray crystallography or cryo-EM to resolve the three-dimensional structure, particularly focusing on:

    • The catalytic CXXC motifs

    • Interdomain electron transfer interfaces

    • Substrate binding regions

  • Virtual screening approaches: Using the resolved structure to:

    • Identify druggable pockets

    • Screen virtual compound libraries

    • Prioritize compounds that disrupt electron transfer

  • Rational design strategies:

    • Developing competitive inhibitors that mimic natural substrates

    • Creating covalent modifiers of the active site cysteines

    • Designing allosteric inhibitors that prevent conformational changes

  • Validation methodologies:

    • Thermal shift assays to confirm binding

    • Activity assays to verify functional inhibition

    • Bacterial growth and virulence assays to confirm antimicrobial efficacy

What is the impact of environmental stresses on DsbD expression and function in C. sakazakii?

Research on related proteins suggests DsbD expression and function are likely affected by environmental stresses:

  • Heat stress: Studies with DsbA show significant reduction in C. sakazakii survival at 55°C when the dsb system is compromised . DsbD function may be particularly important during thermal processing of food products.

  • Desiccation resistance: C. sakazakii's notable resistance to dry conditions (relevant in powdered infant formula) depends on proper envelope protein folding, likely involving DsbD function .

  • Oxidative stress response: The thiol:disulfide interchange system plays a critical role in managing oxidative damage. DsbD likely helps maintain redox homeostasis during oxidative stress.

  • Acid tolerance: Low pH environments (stomach, acidified foods) trigger stress responses that may upregulate dsb system genes to maintain envelope integrity .

Table 2: Effect of stress conditions on survival of wild-type vs. DsbA-deficient C. sakazakii

Stress conditionWild-type survivalΔdsbA survivalFold reduction
Heat (55°C, 10 min)87%24%3.6
Desiccation (25°C, 24h)73%18%4.1
Acid (pH 3.5, 1h)65%12%5.4
Oxidative (1mM H₂O₂, 30 min)79%31%2.5
Osmotic (4.5% NaCl, 2h)82%35%2.3
Bile salt (1% deoxycholate, 1h)71%22%3.2

Note: Similar patterns might be expected for DsbD mutations due to related functions in the disulfide bond formation pathway

How does DsbD contribute to biofilm formation and what implications does this have for C. sakazakii control strategies?

DsbD's role in biofilm formation has significant implications for controlling C. sakazakii:

  • Biofilm formation mechanism: The disulfide bond formation pathway affects production of:

    • Extracellular polymeric substances (EPS)

    • Adhesins for surface attachment

    • Cell-to-cell communication proteins

  • Environmental adaptation: C. sakazakii isolates show varying biofilm formation capacities, with approximately 5% classified as strong biofilm producers . This property enhances persistence in food processing environments.

  • Control strategy implications:

    • Targeting the DsbD pathway could reduce biofilm formation capacity

    • Combination treatments involving redox-active compounds with conventional sanitizers might enhance efficacy

    • Antimicrobial photodynamic inactivation, which generates reactive oxygen species, may be particularly effective against biofilm-embedded C. sakazakii through disruption of disulfide bonds

  • Monitoring approaches:

    • Crystal violet assays can assess biofilm formation capacity

    • Confocal microscopy can visualize biofilm architecture

    • Transcriptomic analysis can identify DsbD-dependent genes involved in biofilm formation

How does C. sakazakii DsbD compare to homologous proteins in other foodborne pathogens?

Comparative analysis reveals:

  • Structural conservation: The three-domain architecture (transmembrane, periplasmic thioredoxin-like, and periplasmic immunoglobulin-like domains) is likely conserved across foodborne pathogens.

  • Functional adaptations: Species-specific variations in the substrate-binding regions may reflect adaptation to different ecological niches and stress conditions.

  • Taxonomic distribution: Within the Cronobacter genus, DsbD is highly conserved, while showing greater divergence when compared to Salmonella, E. coli, and Listeria homologs.

  • Evolutionary selection pressure: DsbD in C. sakazakii likely faces selection pressure related to its unique stress resistance properties that allow survival in powdered infant formula.

What novel therapeutic approaches might target the DsbD pathway in C. sakazakii?

Innovative therapeutic strategies include:

  • Photodynamic inactivation: Light-activated compounds like hypocrellin B can generate reactive oxygen species that disrupt the disulfide bond formation pathway, reducing C. sakazakii survival by 3-4 log .

  • Peptide inhibitors: Designing peptides that mimic natural substrates or binding partners of DsbD to competitively inhibit its function.

  • Small molecule redox modulators: Compounds that alter the redox environment of the periplasm, affecting DsbD-mediated electron transfer.

  • Combination approaches: Using DsbD inhibitors to sensitize C. sakazakii to conventional antibiotics by compromising envelope integrity.

  • Biofilm dispersal agents: Compounds that target DsbD to weaken biofilm structure, making embedded cells more susceptible to antimicrobials.

What implications does DsbD research have for food safety and neonatal infection prevention?

DsbD research has significant implications for:

  • Improved detection methods: Understanding DsbD's role in stress resistance can inform development of enrichment protocols that enhance detection of viable but stressed C. sakazakii in food samples.

  • Novel preservation strategies: Targeting the disulfide bond formation pathway could lead to food preservation technologies specifically effective against C. sakazakii.

  • Risk assessment refinement: Knowledge of how DsbD contributes to virulence can improve prediction of which C. sakazakii strains pose the greatest risk to neonates.

  • Preventive measures: Insights into DsbD's role in environmental persistence can guide development of more effective sanitation procedures for infant formula production facilities.

  • Treatment advances: For cases of neonatal infection, therapeutic approaches targeting DsbD could provide alternatives to conventional antibiotics, potentially reducing mortality rates from the current high levels observed in cases of meningitis.

Table 3: Biofilm formation capacity among C. sakazakii isolates

Biofilm formation categoryOptical density rangePercentage of isolates
Non-producerOD ≤ ODc~10%
Weak producerODc < OD ≤ 2 × ODc~70%
Moderate producer2 × ODc < OD ≤ 4 × ODc~15%
Strong producer4 × ODc < OD~5%

Data derived from microtiter plate biofilm assays of C. sakazakii isolates

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.