Recombinant Cronobacter sakazakii Universal stress protein B (uspB)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Universal Stress Proteins (USPs) are ATP-independent proteins that enhance bacterial survival under environmental stressors (e.g., starvation, osmotic shock, oxidative stress). In Cronobacter sakazakii, USPs like uspB are hypothesized to contribute to stress adaptation, biofilm formation, and virulence.

Key Features of USPs:

  • Function: Modulate cellular stress responses without enzymatic activity.

  • Expression: Regulated by sigma factors like RpoS, which controls stress-responsive genes .

  • Orthologs: Found in pathogens like Salmonella, E. coli, and Enterobacter, where they influence persistence in hostile environments.

Genomic Context

Genomic analyses of C. sakazakii reveal stress-response genes, including those encoding USPs. For example:

  • Stress-Response Genes:

    • rpoS: A sigma factor regulating stress-response genes, including uspB .

    • Toxin-Antitoxin Systems: Identified in C. sakazakii genomes, suggesting stress-induced survival mechanisms .

  • Phylogenetic Clusters: C. sakazakii isolates show genetic diversity, with stress-related genes enriched in accessory genomes .

Functional Role of uspB

Though not explicitly studied in C. sakazakii, uspB homologs in other pathogens:

  • Stress Tolerance: In Enterobacter cloacae, uspB knockdown reduces survival under starvation, acid, and oxidative stress .

  • Biofilm Formation: USPs may enhance biofilm persistence, a trait critical for C. sakazakii’s survival in desiccated environments .

Recombinant USP Proteins: Lessons from Other Species

Recombinant USP proteins are often studied in model organisms to elucidate structural and functional mechanisms. For example:

Recombinant Salmonella paratyphi A uspB

A recombinant S. paratyphi A uspB protein (His-tagged) is commercially available :

PropertyDescription
SequenceFull-length (1–111 amino acids)
SourceExpressed in E. coli
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based, 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL), with optional glycerol (5–50%)

Functional Implications:

  • Stress Response: USPs like uspB may stabilize cellular structures under stress .

  • Structural Flexibility: ATP-independent binding to hydrophobic regions could modulate protein interactions.

Gaps and Future Directions for C. sakazakii uspB

Despite the absence of direct studies on C. sakazakii uspB, research on related USPs highlights critical areas for investigation:

Unanswered Questions

  1. Structural Characteristics:

    • Domain Organization: Does C. sakazakii uspB share conserved motifs (e.g., hydrophobic patches) with Salmonella or E. coli USPs?

  2. Functional Specificity:

    • Regulatory Pathways: How does RpoS mediate uspB expression in C. sakazakii under stress ?

  3. Virulence Linkages:

    • Biofilm and Invasion: Does uspB enhance adhesion to host cells or bacterial persistence in macrophages?

Methodological Recommendations

  • Recombinant Production: Cloning C. sakazakii uspB into E. coli for structural/functional studies.

  • Knockout Experiments: Assessing phenotypic changes in ΔuspB mutants under stress.

  • Proteomic Profiling: Identifying uspB interactions using mass spectrometry .

Comparative Genomic Data

*Table 1: Stress-Related Genes in C. sakazakii

GeneFunctionSource
rpoSSigma factor; regulates stress genes
uspBUniversal stress protein (homologs)
katECatalase (oxidative stress)
dpsDNA-binding protein (starvation)

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For working aliquots, store at 4°C for up to one week.
Reconstitution
Before opening, we recommend briefly centrifuging the vial to concentrate the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
uspB; ESA_04227; Universal stress protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)
Target Names
uspB
Target Protein Sequence
MISTVALFWALFLVCVINMARYFSSLRALLVVLRGCDPLLYQYVDGGGFFTAHGQPSKQI RLVWYIYWQRYLDHHDDEFIRRCERVRRQFILTSALCGLVIISLIGLMIWH
Uniprot No.

Target Background

Database Links
Protein Families
Universal stress protein B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Cronobacter sakazakii and why is it significant in research?

Cronobacter sakazakii is a gram-negative bacterium known for causing rare but often fatal infections, primarily affecting very young infants with weak immune systems. It has been found at low levels in powdered infant formula (PIF) and can cause symptoms including poor feeding response, irritability, jaundice, grunting while breathing, and unstable body temperature1. The significance of researching C. sakazakii lies in its ability to survive harsh environmental conditions and its public health implications. According to recent surveys, approximately 24.7% of homes in the United States tested positive for C. sakazakii, highlighting its prevalence in domestic environments .

What are Universal stress proteins in bacterial systems?

Universal stress proteins (USPs) are a conserved group of proteins found in bacteria, archaea, fungi, plants, and some metazoan organisms that are expressed under various environmental stressors. In bacterial systems like C. sakazakii, these proteins play crucial roles in stress response mechanisms that help the organism survive challenging conditions. Stress response factors previously identified in Cronobacter include responses to heat-shock, cold-stresses, survival in dry conditions, water activity (aw), and pH variations . The uspB gene specifically encodes a universal stress protein that contributes to the bacterium's ability to persist in unfavorable environments, making it an important target for understanding C. sakazakii pathogenicity and survival mechanisms.

How does the uspB gene fit into the broader genomic context of C. sakazakii?

The uspB gene in C. sakazakii is part of the organism's stress response system. Genomic analyses have revealed that C. sakazakii contains several genomic regions with stress-related genes. For instance, research has identified regions like GR-c (genome regions 891,557...912,700) containing stress response elements such as ATP-dependent Clp protease, ATP-binding subunit ClpA, and heat shock proteins . While the search results don't specifically position uspB within these regions, stress response genes typically function as part of integrated networks. The uspB gene likely works in conjunction with other stress response factors to enable the bacterium's remarkable ability to survive in dry conditions for extended periods, which contributes to its persistence in environments such as powdered infant formula.

What molecular mechanisms underlie uspB function during different environmental stressors in C. sakazakii?

The molecular mechanisms of uspB in C. sakazakii likely involve ATP-binding and signal transduction pathways that respond to environmental stressors. While specific details for C. sakazakii uspB aren't directly mentioned in the search results, related research suggests that Universal stress proteins often function through:

  • Conformational changes upon stress detection

  • Protein-protein interactions with stress response regulators

  • Modulation of cellular metabolism during stress conditions

  • Protection of cellular macromolecules from damage

Research design to investigate these mechanisms should incorporate protein structural analysis, protein-protein interaction studies, and gene expression profiling under various stress conditions. Methodologically, researchers should consider employing techniques such as site-directed mutagenesis to identify functional domains, co-immunoprecipitation to detect protein interaction partners, and RNA-seq to analyze transcriptional networks activated during different stress conditions. Growth assays at different temperatures (22°C and 35°C) would be particularly relevant, as these temperatures have shown significant differences in C. sakazakii growth rates and lag phases .

How does uspB expression correlate with C. sakazakii virulence and survival in clinical versus environmental isolates?

This question requires comparative analysis between clinical and environmental isolates of C. sakazakii. Current research indicates significant variability in virulence among different C. sakazakii strains. For example, strain type-4 (ST-4) or clonal complex 4 (CC4) has been associated with invasive infections in infants, particularly meningitis .

To investigate correlations between uspB expression and virulence, researchers should:

  • Collect diverse isolates from both clinical and environmental sources

  • Quantify uspB expression levels using RT-qPCR under standardized conditions

  • Perform virulence assays using cell culture and animal models

  • Analyze survival rates under various stress conditions

Comparative genomic approaches would be valuable here, particularly examining whether gene copy number, sequence variations, or regulatory elements differ between highly virulent and less virulent strains. The presence of toxin-antitoxin pairs, as identified in some Cronobacter genomes , may provide insights into how uspB interacts with broader virulence mechanisms.

What is the role of uspB in the persistence of C. sakazakii in reconstituted powdered infant formula?

The persistence of C. sakazakii in reconstituted powdered infant formula (R-PIF) represents a significant public health concern, as the bacterium can grow rapidly under various temperature conditions. Research has shown that at 35°C, C. sakazakii has a growth rate of 0.73 ± 0.01 log CFU/h with a lag phase of only 0.45 ± 0.03 h and generation time of 0.41 h .

The uspB protein likely contributes to this persistence through:

  • Enhanced survival during desiccation in powdered formula

  • Rapid adaptation when formula is reconstituted with water

  • Stress protection during temperature fluctuations during storage

  • Possible contribution to biofilm formation in feeding equipment

To investigate this experimentally, researchers should:

  • Create uspB knockout mutants using CRISPR-Cas9 or similar gene editing techniques

  • Conduct comparative survival studies in R-PIF under various environmental conditions

  • Examine biofilm formation capability on relevant surfaces (plastic, glass, silicone)

  • Analyze gene expression profiles during transition from dry to reconstituted states

The time required to reach potentially infectious doses (estimated at approximately 1000 CFU) varies significantly with temperature and initial contamination level, as shown in the following data from ComBase modeling:

Initial CFUTime to reach 1000 CFU at 35°C (h)Time to reach 1000 CFU at 22°C (h)
0.15.911.9
14.59.7
103.27.5
1001.85.2

This data highlights the importance of temperature control in limiting C. sakazakii growth in R-PIF .

What are the optimal conditions for expression and purification of recombinant C. sakazakii uspB?

For recombinant expression of C. sakazakii uspB, researchers should consider several methodological approaches:

Expression System Selection:

  • E. coli BL21(DE3) or similar expression strains are typically suitable for bacterial protein expression

  • Consideration of codon optimization based on C. sakazakii codon usage preferences

  • Selection of appropriate expression vectors (pET system commonly used for stress proteins)

Expression Conditions:

  • Induction parameters: IPTG concentration (0.1-1.0 mM), temperature (16-37°C), and duration (4-24 hours)

  • Media composition: Standard LB or enriched media such as Terrific Broth

  • Scale-up considerations for larger yields

Purification Strategy:

  • Affinity chromatography using histidine tags or other fusion tags

  • Size exclusion chromatography for further purification

  • Ion exchange chromatography if needed based on protein properties

Quality Control:

  • SDS-PAGE and Western blot for purity assessment

  • Mass spectrometry for identity confirmation

  • Circular dichroism for secondary structure verification

  • Functional assays to confirm protein activity

While specific conditions for uspB expression aren't detailed in the search results, researchers should be mindful that C. sakazakii's stress proteins function optimally at various temperatures, with growth studies showing significant activity at both 22°C and 35°C .

How can researchers effectively design knockout and complementation studies for uspB in C. sakazakii?

Designing effective knockout and complementation studies for uspB in C. sakazakii requires careful methodological planning:

Knockout Strategy:

  • CRISPR-Cas9 system optimized for C. sakazakii

    • Design guide RNAs targeting conserved regions of uspB

    • Construct delivery plasmids with appropriate selection markers

    • Screen transformants using PCR and sequencing verification

  • Homologous recombination approach

    • Construct targeting vectors with antibiotic resistance cassettes

    • Include sufficient homology arms (typically 500-1000 bp)

    • Use counter-selection strategies to isolate double crossover events

Complementation Strategy:

  • Site-specific chromosomal integration

    • Use integrative plasmids for stable expression

    • Place uspB under native promoter for physiological expression

    • Include verification tags without disrupting protein function

  • Plasmid-based complementation

    • Use low or medium-copy plasmids to prevent overexpression artifacts

    • Include inducible promoters for controlled expression studies

    • Ensure plasmid stability through appropriate selection

Phenotypic Characterization:

  • Growth curves under various stress conditions

    • Temperature stress (comparison at 22°C and 35°C)

    • Desiccation resistance and recovery

    • pH and osmotic stress tolerance

  • Virulence assessment

    • Cell invasion assays

    • Biofilm formation capacity

    • Animal models where appropriate

  • Molecular characterization

    • Transcriptomic analysis of compensatory mechanisms

    • Proteomic analysis of stress response networks

These approaches should be designed with consideration of C. sakazakii's genomic features, including potential redundancy in stress response mechanisms, as suggested by the presence of multiple stress response genes identified in genomic regions .

How should researchers analyze transcriptomic data to identify co-regulated genes with uspB under different stress conditions?

Analyzing transcriptomic data to identify genes co-regulated with uspB requires sophisticated bioinformatic approaches:

Data Collection Strategy:

  • Design RNA-seq experiments with appropriate biological replicates (minimum 3-4)

  • Include multiple stress conditions relevant to C. sakazakii ecology:

    • Temperature variations (22°C and 35°C, based on known growth parameters)

    • Desiccation and rehydration cycles

    • pH fluctuations

    • Nutrient limitation scenarios

Bioinformatic Analysis Pipeline:

  • Quality control and preprocessing

    • Adapter trimming and quality filtering

    • rRNA depletion assessment

    • Read mapping to C. sakazakii reference genome

  • Differential expression analysis

    • Use DESeq2, edgeR, or similar statistical frameworks

    • Apply appropriate multiple testing corrections

    • Define significance thresholds (typically adjusted p < 0.05 and fold change > 2)

  • Co-expression network analysis

    • Weighted Gene Co-expression Network Analysis (WGCNA)

    • Identification of modules containing uspB

    • Hub gene identification within these modules

  • Regulatory motif analysis

    • Promoter analysis of co-expressed genes

    • Identification of shared transcription factor binding sites

    • Integration with known stress response regulons

Interpretation Framework:

  • Pathway enrichment analysis to identify biological processes co-regulated with uspB

  • Comparison with known stress regulons from related bacteria

  • Integration with phenotypic data from uspB mutants

  • Validation of key findings with RT-qPCR or reporter constructs

When interpreting results, researchers should be mindful of C. sakazakii's genomic features, including the presence of multiple stress response genes and potential toxin-antitoxin systems that may function alongside uspB in stress adaptation .

What statistical approaches are most appropriate for analyzing uspB protein interaction data?

Analyzing protein interaction data for uspB requires tailored statistical approaches depending on the experimental methodology:

For Yeast Two-Hybrid or Bacterial Two-Hybrid Data:

  • Binary interaction scoring

    • Implementation of appropriate confidence scoring systems

    • Filtering of false positives using control interactions

    • Statistical comparison against random interaction background

  • Network analysis

    • Calculation of topological parameters (degree, betweenness, clustering)

    • Enrichment analysis of interaction partners

    • Comparison with known interaction databases

For Co-Immunoprecipitation with Mass Spectrometry:

  • Spectral counting approaches

    • Normalized spectral abundance factors (NSAF)

    • Exponentially modified protein abundance index (emPAI)

    • Statistical testing using negative binomial models

  • Intensity-based approaches

    • MS1 intensity quantification

    • iBAQ or similar intensity normalization

    • LIMMA or similar statistical frameworks for differential interaction

For Proximity Labeling Approaches (BioID, APEX):

  • Enrichment analysis

    • SAINT algorithm for scoring interactions

    • Bayesian approaches for confidence estimation

    • Fold-change and significance thresholds

Validation and Interpretation:

  • Orthogonal validation of key interactions using alternative methods

  • Functional categorization of interaction partners

  • Integration with transcriptomic data, particularly under stress conditions

  • Comparative analysis across different stress conditions

When analyzing protein interactions, researchers should consider the genomic and proteomic context of C. sakazakii, including potential redundancy in stress response mechanisms and the presence of other stress-related proteins that may function in concert with uspB .

How can understanding uspB function contribute to improved detection methods for C. sakazakii in food safety applications?

Understanding uspB function could significantly advance C. sakazakii detection methods by targeting stress-response mechanisms that enable the bacterium's survival in food products. Current detection methods have shown varying success rates, with confirmation rates of 88.7% for C. sakazakii from presumptive positive samples . Improved detection based on uspB knowledge could include:

Molecular Detection Approaches:

  • PCR-based methods targeting uspB and related stress genes

    • Development of multiplex PCR assays incorporating uspB

    • Design of primers targeting conserved regions of uspB

    • Quantitative PCR approaches to determine viable cell counts

  • Biosensor development

    • Antibody-based detection targeting uspB protein

    • Aptamer selection against recombinant uspB

    • CRISPR-Cas biosensing platforms

Enrichment Optimization:

  • Stress-based selective enrichment

    • Leveraging knowledge of uspB function to design selective conditions

    • Optimizing temperature cycling based on known growth parameters (22°C/35°C)

    • Including specific stress factors that induce uspB expression

Validation Studies:

  • Comparison with existing methods using naturally contaminated samples

  • Determination of detection limits and time-to-result

  • Assessment of method robustness across different food matrices

Practical implementation would require consideration of C. sakazakii prevalence in domestic environments, with studies showing 36.1% of US homes testing positive for Cronobacter species and 24.7% specifically positive for C. sakazakii .

What are the future research directions for understanding the evolutionary conservation of uspB across different Cronobacter species?

Future research on evolutionary conservation of uspB should explore its presence and function across all seven Cronobacter species, with particular attention to species-specific adaptations. The search results indicate varying prevalence rates of different Cronobacter species in domestic environments: 6.5% for C. turicensis, 3.8% for C. malonaticus, 3.4% for C. dublinensis, 2.3% for C. muytjensii, and 0.8% for C. universalis .

Key Research Directions:

  • Comparative genomic analysis

    • Sequence conservation analysis of uspB across all Cronobacter species

    • Identification of species-specific variations in uspB sequence and structure

    • Analysis of selection pressures on uspB using dN/dS ratios

    • Examination of genomic context and operon structure across species

  • Functional conservation studies

    • Heterologous expression of uspB from different Cronobacter species

    • Complementation studies in uspB knockout strains

    • Stress response profiling across species

    • Protein structure comparison through crystallography or cryo-EM

  • Ecological and niche adaptation analysis

    • Correlation between uspB variants and ecological niches

    • Relationship between uspB sequence and host range/pathogenicity

    • Environmental distribution patterns of different uspB variants

  • Evolutionary modeling

    • Reconstruction of ancestral uspB sequences

    • Estimation of divergence times for uspB variants

    • Identification of horizontal gene transfer events involving uspB

This research would benefit from integration with existing knowledge about genomic regions and stress response factors already identified in Cronobacter species, particularly the stress-related genes found in specific genomic regions like GR-c (genome regions 891,557...912,700) .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.