Recombinant Cronobacter sakazakii Zinc transport protein ZntB (zntB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Cronobacter sakazakii Zinc Transport Protein ZntB (zntB)

Cronobacter sakazakii is an opportunistic foodborne pathogen that can cause life-threatening conditions, such as septicemia and meningitis, particularly in neonates and immunocompromised infants . Zinc transport protein ZntB (zntB) plays a crucial role in zinc homeostasis within the bacterium . ZntB is a protein involved in the transport of zinc ions across the cell membrane . The recombinant form of this protein, produced using genetic engineering techniques, is utilized in various research applications .

Characteristics of ZntB

ZntB is a zinc transport protein that, in Cronobacter sakazakii, is encoded by the zntB gene . The recombinant full-length Cronobacter sakazakii ZntB protein typically consists of 327 amino acids . The protein is expressed in E. coli and fused to an N-terminal His tag to facilitate purification .

Key Characteristics of Recombinant ZntB:

  • Source Organism: Cronobacter sakazakii

  • Protein Length: 327 amino acids (full length)

  • Tag: N-terminal His tag

  • Expression Host: E. coli

  • UniProt Accession Number: A7MLI3

  • AA Sequence: MEAIKGSEVNVPDAVIAWLLDGHGGVKPLQDDAVIDKDHPCWLHLNYANPESAQWLTETPLLPNLVRDALAGESLRPRVTRMGDGTLITLRCINGSTDERPDQLVAMRLYIDERLIVSTRQRKVLALDDIIHDLNEGSGPADVGGWLVDACDALTDHASEFIEELHDKIIDLEDNLLEEI VPPRGVLALLRKQLIVMRRYMSPQRDVFSRLASERFSWMTDDHRRRMQDIADRLGRGLDE IDACIARTAVMADEISQTMQESLSRRSYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWH LGFSVFCVALVLLIGGVTWWLHRSKWL

Applications of Recombinant ZntB

Recombinant ZntB has several applications in research, including:

  • ELISA assays: Recombinant ZntB can be used as an antigen in Enzyme-Linked Immunosorbent Assays (ELISA) to detect and quantify antibodies against Cronobacter sakazakii .

  • Protein Structure and Function Studies: The availability of recombinant ZntB allows researchers to investigate its structure and function in detail, providing insights into the mechanisms of zinc transport and homeostasis in bacteria .

  • Drug Discovery: ZntB is a potential target for developing new antibacterial agents. Inhibiting ZntB function could disrupt zinc homeostasis in C. sakazakii, leading to bacterial cell death .

  • Vaccine Development: Recombinant ZntB can be explored as a vaccine candidate to elicit an immune response against C. sakazakii .

Antibiotic Resistance and Virulence

Cronobacter sakazakii strains exhibit resistance to various antibiotics, which complicates treatment of infections . Some strains have shown resistance to antibiotics like tetracycline, neomycin, and cephalotin . The presence of genes such as ampC, fosA, gyrA, gyrB, parC, and parB contributes to antibiotic resistance in C. sakazakii .

Furthermore, C. sakazakii strains can adhere to cell lines and possess diverse virulence factors . The bacterium can persist and multiply within phagocytic macrophage and microglial cells, enhancing its ability to cause invasive infections .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
zntB; ESA_01672; Zinc transport protein ZntB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)
Target Names
zntB
Target Protein Sequence
MEAIKGSEVNVPDAVIAWLLDGHGGVKPLQDDAVIDKDHPCWLHLNYANPESAQWLTETP LLPNLVRDALAGESLRPRVTRMGDGTLITLRCINGSTDERPDQLVAMRLYIDERLIVSTR QRKVLALDDIIHDLNEGSGPADVGGWLVDACDALTDHASEFIEELHDKIIDLEDNLLEEI VPPRGVLALLRKQLIVMRRYMSPQRDVFSRLASERFSWMTDDHRRRMQDIADRLGRGLDE IDACIARTAVMADEISQTMQESLSRRSYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWH LGFSVFCVALVLLIGGVTWWLHRSKWL
Uniprot No.

Target Background

Function
Mediates zinc ion efflux.
Database Links
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ZntB and what is its primary function in C. sakazakii?

ZntB is a zinc efflux transporter belonging to the CorA metal ion transporter (MIT) family (TC 1.A.35) that mediates zinc ion efflux, protecting bacterial cells from zinc toxicity and maintaining intracellular metal homeostasis. The protein consists of 327 amino acids in its full-length form and plays a crucial role in maintaining zinc homeostasis in C. sakazakii . While not directly linked to virulence, zinc homeostasis is critical for bacterial survival under host-induced metal stress conditions, making ZntB an important protein for bacterial physiology and potentially pathogenesis.

What expression systems are most effective for producing recombinant ZntB?

Recombinant ZntB is most commonly expressed in heterologous systems including Escherichia coli, yeast, or mammalian cells. E. coli is the most frequently used system due to its high yield, ease of genetic manipulation, and cost-effectiveness . When selecting an expression system, researchers should consider:

  • E. coli systems: Optimal for high-yield production but may face challenges with membrane protein folding

  • Yeast systems: Better for eukaryotic post-translational modifications

  • Mammalian cells: Provide the most native-like processing but are more expensive and lower-yielding

For most structural and functional studies, E. coli expression remains the standard approach due to established protocols and higher protein yields .

What are the recommended purification strategies for recombinant ZntB?

Recombinant ZntB is typically fused with affinity tags, particularly His-tags (hexahistidine), for simplified purification . The recommended purification workflow includes:

  • Cell lysis: Using sonication or French press in a buffer containing appropriate detergents for membrane protein extraction

  • Affinity chromatography: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Size exclusion chromatography: To separate monomeric from aggregated protein

  • Storage: The purified protein should be stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0

For long-term storage, it is recommended to add 5-50% glycerol (final concentration) and store in aliquots at -20°C/-80°C to avoid repeated freeze-thaw cycles that can compromise protein integrity .

How can researchers effectively study ZntB-mediated zinc transport in vitro?

To investigate ZntB-mediated zinc transport, researchers can employ several complementary approaches:

  • Proteoliposome reconstitution: Purified ZntB can be reconstituted into liposomes with zinc-sensitive fluorescent dyes (like FluoZin-3) inside to measure transport activity

  • Radioisotope assays: Using 65Zn to track transport across membranes containing ZntB

  • Whole-cell metal accumulation: Compare zinc accumulation in bacterial cells expressing wild-type versus mutant ZntB

  • Electrophysiology: Characterize the electrogenic properties of ZntB in planar lipid bilayers

  • Inhibitor studies: Screen for compounds that block ZntB function

These methodologies should be accompanied by proper controls, including inactive mutants of ZntB and measurements under various pH and competing ion conditions to fully characterize transport kinetics and specificity.

What structural domains of ZntB are critical for its function, and how can they be analyzed?

Based on structural studies of related CorA family transporters, several domains are likely critical for ZntB function:

  • Transmembrane domains: The C-terminal region contains transmembrane segments that form the zinc permeation pathway

  • Metal-binding sites: Likely contain conserved acidic residues (Asp, Glu) that coordinate zinc ions

  • Regulatory domains: N-terminal cytoplasmic domains may be involved in sensing zinc levels

Researchers can analyze these domains through:

  • Site-directed mutagenesis: Systematically mutating key residues to assess their role in transport

  • Truncation analysis: Creating various length constructs to identify minimal functional units

  • Crosslinking studies: Identifying residues in proximity during different conformational states

  • Molecular dynamics simulations: Predicting conformational changes during transport cycles

The amino acid sequence provided in section 1.2 serves as the foundation for designing these structure-function studies .

How does ZntB contribute to C. sakazakii virulence and survival in host environments?

While ZntB is not directly categorized as a virulence factor, its role in metal homeostasis significantly impacts C. sakazakii survival during infection. Key aspects include:

  • Nutritional immunity: Host organisms restrict zinc availability as a defense mechanism; ZntB may help bacteria adapt to fluctuating zinc levels

  • Toxicity protection: Phagocytes may release zinc at toxic levels to kill bacteria; ZntB efflux protects against this defense mechanism

  • Biofilm formation: Metal homeostasis affects biofilm development, and C. sakazakii isolates show varying biofilm formation abilities

A comprehensive study of 15 C. sakazakii isolates showed that most produced weak biofilms, with some environmental isolates (particularly from soil samples) producing strong biofilms . These biofilms may provide protection against antimicrobials and environmental stresses, potentially contributing to persistence in manufacturing facilities.

What is the relationship between ZntB function and antibiotic resistance in C. sakazakii?

  • Antibiotic uptake: Changes in membrane permeability due to altered metal concentrations

  • Stress responses: Metal stress response pathways that may cross-protect against antibiotics

  • Co-regulation: Potential co-regulation of metal transporters and antibiotic resistance genes

Future research should explore whether inhibition of ZntB sensitizes C. sakazakii to antibiotics or host defense mechanisms, which could reveal new combination therapeutic approaches .

How conserved is ZntB across Cronobacter species and related bacteria?

ZntB is relatively conserved across Cronobacter species, but comparative genomic analysis reveals species-specific variations. The zntB gene (KEGG: esa:ESA_01672) is found in various Cronobacter strains. A comprehensive genomic analysis of Cronobacter isolates reveals:

  • Core genome location: ZntB is part of the core genome shared across most Cronobacter species

  • Sequence conservation: High amino acid sequence similarity among Cronobacter species, but with key variations in potential metal-binding residues

  • Phylogenetic distribution: Present in related Enterobacteriaceae but with varying functional capacities

When designing experiments with ZntB, researchers should consider strain-specific variations that might affect protein function or expression levels. The phylogenetic analysis of Cronobacter species shows distinct clustering by sequence types, which may correlate with ZntB functional variations .

What genomic neighborhoods and regulatory elements control ZntB expression?

The regulation of zntB expression likely involves:

  • Metal-responsive regulators: Zinc-sensing transcription factors that control expression based on intracellular zinc levels

  • Promoter elements: Specific sequences recognized by metal-responsive regulators

  • Co-regulated genes: Other genes in the same operon or regulon that function in metal homeostasis

Researchers studying ZntB regulation should consider:

  • Promoter analysis: Identifying binding sites for known metal regulators

  • Transcriptomics: RNA-seq under varying zinc concentrations to determine expression patterns

  • Reporter assays: Using promoter-reporter fusions to measure expression dynamics

Understanding these regulatory mechanisms is crucial for interpreting the role of ZntB in different environmental contexts and potentially manipulating its expression for research or therapeutic purposes.

How might ZntB serve as a target for novel antimicrobial strategies?

As a critical component of metal homeostasis, ZntB represents a potential target for antimicrobial development against C. sakazakii. Promising research directions include:

  • Small molecule inhibitors: Developing compounds that specifically block ZntB transport function

  • Zinc ionophores: Creating molecules that bypass ZntB control and deliver toxic zinc levels into bacteria

  • Combination therapies: Using ZntB inhibitors to sensitize bacteria to conventional antibiotics

  • Vaccine development: Considering ZntB as a potential vaccine candidate, similar to other C. sakazakii proteins like GroEL and OmpX that have shown immunogenic potential

Previous studies have demonstrated that recombinant proteins from C. sakazakii can induce protective immunity in animal models, suggesting similar approaches might be viable with ZntB .

What challenges exist in working with recombinant ZntB and how can they be overcome?

Researchers working with recombinant ZntB face several technical challenges:

  • Membrane protein solubility: As a membrane protein, ZntB can be difficult to maintain in a soluble, functional state

    • Solution: Use appropriate detergents or nanodiscs for stabilization

  • Functional assays: Demonstrating transport activity in vitro requires specialized systems

    • Solution: Develop robust proteoliposome systems with appropriate zinc detection methods

  • Structural studies: Obtaining high-resolution structures of membrane transporters is challenging

    • Solution: Consider cryo-EM approaches or crystallization in lipidic cubic phases

  • Expression toxicity: Overexpression of transporters can disrupt host cell membrane integrity

    • Solution: Use tightly controlled inducible expression systems and optimize induction conditions

  • Stability during purification: ZntB may denature during purification steps

    • Solution: Include stabilizing agents like trehalose (6%) in buffers and avoid repeated freeze-thaw cycles

By addressing these challenges with appropriate methodological approaches, researchers can effectively study ZntB structure and function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.