Cronobacter sakazakii is an opportunistic foodborne pathogen that can cause life-threatening conditions, such as septicemia and meningitis, particularly in neonates and immunocompromised infants . Zinc transport protein ZntB (zntB) plays a crucial role in zinc homeostasis within the bacterium . ZntB is a protein involved in the transport of zinc ions across the cell membrane . The recombinant form of this protein, produced using genetic engineering techniques, is utilized in various research applications .
ZntB is a zinc transport protein that, in Cronobacter sakazakii, is encoded by the zntB gene . The recombinant full-length Cronobacter sakazakii ZntB protein typically consists of 327 amino acids . The protein is expressed in E. coli and fused to an N-terminal His tag to facilitate purification .
Key Characteristics of Recombinant ZntB:
AA Sequence: MEAIKGSEVNVPDAVIAWLLDGHGGVKPLQDDAVIDKDHPCWLHLNYANPESAQWLTETPLLPNLVRDALAGESLRPRVTRMGDGTLITLRCINGSTDERPDQLVAMRLYIDERLIVSTRQRKVLALDDIIHDLNEGSGPADVGGWLVDACDALTDHASEFIEELHDKIIDLEDNLLEEI VPPRGVLALLRKQLIVMRRYMSPQRDVFSRLASERFSWMTDDHRRRMQDIADRLGRGLDE IDACIARTAVMADEISQTMQESLSRRSYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWH LGFSVFCVALVLLIGGVTWWLHRSKWL
Recombinant ZntB has several applications in research, including:
ELISA assays: Recombinant ZntB can be used as an antigen in Enzyme-Linked Immunosorbent Assays (ELISA) to detect and quantify antibodies against Cronobacter sakazakii .
Protein Structure and Function Studies: The availability of recombinant ZntB allows researchers to investigate its structure and function in detail, providing insights into the mechanisms of zinc transport and homeostasis in bacteria .
Drug Discovery: ZntB is a potential target for developing new antibacterial agents. Inhibiting ZntB function could disrupt zinc homeostasis in C. sakazakii, leading to bacterial cell death .
Vaccine Development: Recombinant ZntB can be explored as a vaccine candidate to elicit an immune response against C. sakazakii .
Cronobacter sakazakii strains exhibit resistance to various antibiotics, which complicates treatment of infections . Some strains have shown resistance to antibiotics like tetracycline, neomycin, and cephalotin . The presence of genes such as ampC, fosA, gyrA, gyrB, parC, and parB contributes to antibiotic resistance in C. sakazakii .
Furthermore, C. sakazakii strains can adhere to cell lines and possess diverse virulence factors . The bacterium can persist and multiply within phagocytic macrophage and microglial cells, enhancing its ability to cause invasive infections .
KEGG: esa:ESA_01672
STRING: 290339.ESA_01672
ZntB is a zinc efflux transporter belonging to the CorA metal ion transporter (MIT) family (TC 1.A.35) that mediates zinc ion efflux, protecting bacterial cells from zinc toxicity and maintaining intracellular metal homeostasis. The protein consists of 327 amino acids in its full-length form and plays a crucial role in maintaining zinc homeostasis in C. sakazakii . While not directly linked to virulence, zinc homeostasis is critical for bacterial survival under host-induced metal stress conditions, making ZntB an important protein for bacterial physiology and potentially pathogenesis.
Recombinant ZntB is most commonly expressed in heterologous systems including Escherichia coli, yeast, or mammalian cells. E. coli is the most frequently used system due to its high yield, ease of genetic manipulation, and cost-effectiveness . When selecting an expression system, researchers should consider:
E. coli systems: Optimal for high-yield production but may face challenges with membrane protein folding
Yeast systems: Better for eukaryotic post-translational modifications
Mammalian cells: Provide the most native-like processing but are more expensive and lower-yielding
For most structural and functional studies, E. coli expression remains the standard approach due to established protocols and higher protein yields .
Recombinant ZntB is typically fused with affinity tags, particularly His-tags (hexahistidine), for simplified purification . The recommended purification workflow includes:
Cell lysis: Using sonication or French press in a buffer containing appropriate detergents for membrane protein extraction
Affinity chromatography: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin
Size exclusion chromatography: To separate monomeric from aggregated protein
Storage: The purified protein should be stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0
For long-term storage, it is recommended to add 5-50% glycerol (final concentration) and store in aliquots at -20°C/-80°C to avoid repeated freeze-thaw cycles that can compromise protein integrity .
To investigate ZntB-mediated zinc transport, researchers can employ several complementary approaches:
Proteoliposome reconstitution: Purified ZntB can be reconstituted into liposomes with zinc-sensitive fluorescent dyes (like FluoZin-3) inside to measure transport activity
Radioisotope assays: Using 65Zn to track transport across membranes containing ZntB
Whole-cell metal accumulation: Compare zinc accumulation in bacterial cells expressing wild-type versus mutant ZntB
Electrophysiology: Characterize the electrogenic properties of ZntB in planar lipid bilayers
Inhibitor studies: Screen for compounds that block ZntB function
These methodologies should be accompanied by proper controls, including inactive mutants of ZntB and measurements under various pH and competing ion conditions to fully characterize transport kinetics and specificity.
Based on structural studies of related CorA family transporters, several domains are likely critical for ZntB function:
Transmembrane domains: The C-terminal region contains transmembrane segments that form the zinc permeation pathway
Metal-binding sites: Likely contain conserved acidic residues (Asp, Glu) that coordinate zinc ions
Regulatory domains: N-terminal cytoplasmic domains may be involved in sensing zinc levels
Researchers can analyze these domains through:
Site-directed mutagenesis: Systematically mutating key residues to assess their role in transport
Truncation analysis: Creating various length constructs to identify minimal functional units
Crosslinking studies: Identifying residues in proximity during different conformational states
Molecular dynamics simulations: Predicting conformational changes during transport cycles
The amino acid sequence provided in section 1.2 serves as the foundation for designing these structure-function studies .
While ZntB is not directly categorized as a virulence factor, its role in metal homeostasis significantly impacts C. sakazakii survival during infection. Key aspects include:
Nutritional immunity: Host organisms restrict zinc availability as a defense mechanism; ZntB may help bacteria adapt to fluctuating zinc levels
Toxicity protection: Phagocytes may release zinc at toxic levels to kill bacteria; ZntB efflux protects against this defense mechanism
Biofilm formation: Metal homeostasis affects biofilm development, and C. sakazakii isolates show varying biofilm formation abilities
A comprehensive study of 15 C. sakazakii isolates showed that most produced weak biofilms, with some environmental isolates (particularly from soil samples) producing strong biofilms . These biofilms may provide protection against antimicrobials and environmental stresses, potentially contributing to persistence in manufacturing facilities.
Antibiotic uptake: Changes in membrane permeability due to altered metal concentrations
Stress responses: Metal stress response pathways that may cross-protect against antibiotics
Co-regulation: Potential co-regulation of metal transporters and antibiotic resistance genes
Future research should explore whether inhibition of ZntB sensitizes C. sakazakii to antibiotics or host defense mechanisms, which could reveal new combination therapeutic approaches .
ZntB is relatively conserved across Cronobacter species, but comparative genomic analysis reveals species-specific variations. The zntB gene (KEGG: esa:ESA_01672) is found in various Cronobacter strains. A comprehensive genomic analysis of Cronobacter isolates reveals:
Core genome location: ZntB is part of the core genome shared across most Cronobacter species
Sequence conservation: High amino acid sequence similarity among Cronobacter species, but with key variations in potential metal-binding residues
Phylogenetic distribution: Present in related Enterobacteriaceae but with varying functional capacities
When designing experiments with ZntB, researchers should consider strain-specific variations that might affect protein function or expression levels. The phylogenetic analysis of Cronobacter species shows distinct clustering by sequence types, which may correlate with ZntB functional variations .
The regulation of zntB expression likely involves:
Metal-responsive regulators: Zinc-sensing transcription factors that control expression based on intracellular zinc levels
Promoter elements: Specific sequences recognized by metal-responsive regulators
Co-regulated genes: Other genes in the same operon or regulon that function in metal homeostasis
Researchers studying ZntB regulation should consider:
Promoter analysis: Identifying binding sites for known metal regulators
Transcriptomics: RNA-seq under varying zinc concentrations to determine expression patterns
Reporter assays: Using promoter-reporter fusions to measure expression dynamics
Understanding these regulatory mechanisms is crucial for interpreting the role of ZntB in different environmental contexts and potentially manipulating its expression for research or therapeutic purposes.
As a critical component of metal homeostasis, ZntB represents a potential target for antimicrobial development against C. sakazakii. Promising research directions include:
Small molecule inhibitors: Developing compounds that specifically block ZntB transport function
Zinc ionophores: Creating molecules that bypass ZntB control and deliver toxic zinc levels into bacteria
Combination therapies: Using ZntB inhibitors to sensitize bacteria to conventional antibiotics
Vaccine development: Considering ZntB as a potential vaccine candidate, similar to other C. sakazakii proteins like GroEL and OmpX that have shown immunogenic potential
Previous studies have demonstrated that recombinant proteins from C. sakazakii can induce protective immunity in animal models, suggesting similar approaches might be viable with ZntB .
Researchers working with recombinant ZntB face several technical challenges:
Membrane protein solubility: As a membrane protein, ZntB can be difficult to maintain in a soluble, functional state
Solution: Use appropriate detergents or nanodiscs for stabilization
Functional assays: Demonstrating transport activity in vitro requires specialized systems
Solution: Develop robust proteoliposome systems with appropriate zinc detection methods
Structural studies: Obtaining high-resolution structures of membrane transporters is challenging
Solution: Consider cryo-EM approaches or crystallization in lipidic cubic phases
Expression toxicity: Overexpression of transporters can disrupt host cell membrane integrity
Solution: Use tightly controlled inducible expression systems and optimize induction conditions
Stability during purification: ZntB may denature during purification steps
By addressing these challenges with appropriate methodological approaches, researchers can effectively study ZntB structure and function.