Recombinant Crotalus adamanteus NADH-ubiquinone oxidoreductase chain 4 (MT-ND4)

What is NADH-ubiquinone oxidoreductase chain 4 (MT-ND4) and what is its role in cellular function?

MT-ND4 is a protein subunit of mitochondrial Complex I (NADH dehydrogenase), which plays a critical role in the electron transport chain during oxidative phosphorylation. As part of Complex I, MT-ND4 contributes to the first step in electron transport, transferring electrons from NADH to ubiquinone. This process is fundamental to energy production in the cell, as it helps create the electrochemical gradient across the inner mitochondrial membrane that drives ATP synthesis. The protein is encoded by the mitochondrial genome rather than the nuclear genome, making it particularly relevant for studies of mitochondrial genetics and function .

In Crotalus adamanteus (Eastern diamondback rattlesnake), MT-ND4 maintains this essential role in energy metabolism. The recombinant version of this protein provides researchers with a valuable tool for studying Complex I structure, function, and evolution across different species. The protein is characterized as a transmembrane protein with a full sequence length of 231 amino acids when produced recombinantly .

How does the structure of MT-ND4 from Crotalus adamanteus compare to human MT-ND4?

While the search results don't provide a direct comparison, we can infer structural similarities and differences based on evolutionary conservation of mitochondrial proteins. MT-ND4 is highly conserved across species due to its essential role in energy metabolism, but species-specific variations exist that may affect protein folding, membrane integration, or interaction with other Complex I subunits.

The Crotalus adamanteus MT-ND4 sequence (partial provided in the data sheet) shows the characteristic hydrophobic regions expected for a transmembrane protein: "PIAGSMVLAAILLKLGGYGIIRMMQILPTTKTDLFLPFIVLALWGAILANLTCLQQTDLKSLIAYSSISHMGLVVAAIIIQTPWGLSGAMALMIAHGFTSSALFCLANTTYERTHTRILILTRGFHNILPMATTWWLVTNLMNIAIPPSMNFTGELLIMSALFNWCPTTIIMLGLSMLITASYSLHMFLSTQMGPTMLNNQTEPMHSREHLLIALHLAPLLMISLKPELVI" .

Researchers interested in comparative studies should perform detailed sequence alignments and structural predictions to identify conserved domains and species-specific regions that might influence functional characteristics.

How can recombinant MT-ND4 be utilized in mitochondrial disease research?

Recombinant MT-ND4 serves as a powerful tool in mitochondrial disease research, particularly for conditions like Leber hereditary optic neuropathy (LHON). The protein can be used in multiple experimental contexts:

• As a control in functional assays: Researchers can use wild-type recombinant MT-ND4 as a control when studying mutant variants associated with disease.

• For structural studies: The recombinant protein facilitates investigations into how disease-causing mutations affect protein structure.

• In gene therapy development: Studies have demonstrated that allotopic expression of human ND4 can prevent retinal ganglion cell degeneration and preserve Complex I function in optic nerves in models of LHON .

• For antibody development and validation: The recombinant protein can be used to develop and validate antibodies for detecting endogenous MT-ND4 in experimental and clinical samples.

When applied to LHON research specifically, recombinant ND4 has contributed to therapeutic advances. Research has shown that nuclear expression of this mitochondrial protein, when properly targeted to mitochondria using specific signal sequences (like those from COX10), can rescue respiratory chain dysfunction in cells harboring ND4 mutations .

What methods are available for quantifying MT-ND4 gene deletions in research samples?

Researchers have developed sophisticated methods to quantify MT-ND4 gene deletions, which are often associated with mitochondrial disorders and aging. A particularly robust approach is the triplex real-time PCR assay that simultaneously amplifies three mitochondrial targets:

• MT-ND4 gene (located in the major arc of mtDNA)

• MT-ND1 gene (located in the minor arc)

• The non-coding D-Loop region (which is typically conserved in mtDNA molecules with deletions)

This method enables researchers to detect and quantify a broad spectrum of mtDNA deletions by comparing the relative abundance of these three targets. The assay has been validated for both sensitivity and precision in detecting deletions in both aging and disease tissues .

The technical protocol involves:

• Using specific primer sets for each target region

• Employing different fluorescent probes for each target (e.g., FAM for MT-ND4)

• Validating amplification efficiencies through standard curves

• Calculating deletion levels through comparative ratios of MT-ND4/D-Loop and MT-ND4/MT-ND1

The expected ratios for normal samples are approximately 100%, while deviations from this value indicate deletions. In validation studies, researchers have demonstrated that this assay can precisely detect various proportions of deletion mixtures, with measured ratios of MT-ND1/D-Loop, MT-ND4/D-Loop, and MT-ND4/MT-ND1 showing high consistency with expected values (typically 102-113%) .

What are the optimal storage conditions for maintaining the stability of recombinant MT-ND4 protein?

Proper storage is critical for maintaining the stability and functionality of recombinant MT-ND4. According to product specifications, the following storage guidelines should be followed:

• Standard storage: Store at -20°C for routine use.

• Long-term storage: For extended storage periods, conserve at -20°C or preferably -80°C.

• Working aliquots: Store at 4°C for up to one week only.

• Avoid freeze-thaw cycles: Repeated freezing and thawing significantly compromises protein stability and should be avoided .

The shelf life of recombinant MT-ND4 varies depending on formulation:

• Liquid formulations: Approximately 6 months when stored at -20°C/-80°C

• Lyophilized formulations: Up to 12 months when stored at -20°C/-80°C

It's important to note that shelf life is influenced by multiple factors beyond storage temperature, including:

• Buffer composition

• Presence of stabilizing agents

• Initial protein concentration

• Inherent stability characteristics of the specific protein variant

For experiments requiring precise quantification or functional assays, researchers should verify protein integrity before use, particularly for samples approaching the end of their expected shelf life.

What expression systems are most effective for producing functional recombinant MT-ND4?

The production of functional recombinant MT-ND4 presents unique challenges due to its hydrophobic nature and normal location within the inner mitochondrial membrane. Based on available data, the following expression system has been successfully employed:

• E. coli expression system: The recombinant Crotalus adamanteus MT-ND4 protein has been successfully produced using in vitro E. coli expression systems . This approach typically involves:

  • Codon optimization for E. coli

  • Use of strong, inducible promoters

  • Addition of fusion tags to aid solubility and purification (e.g., N-terminal 10xHis-tag as used for commercial products)

For research applications requiring properly folded and functional protein, several considerations should be addressed:

• Membrane protein expression challenges: As a transmembrane protein, MT-ND4 may require specialized expression strains or conditions to facilitate proper membrane insertion.

• Protein refolding: Depending on the expression system, additional refolding steps may be necessary to achieve native conformation after purification.

• Verification of functionality: Activity assays measuring electron transfer capacity should be employed to confirm that the recombinant protein retains functional properties.

When designing expression systems for MT-ND4, researchers should carefully consider the intended application and required protein characteristics, as different experimental contexts may necessitate different optimization strategies.

How can allotopic expression of MT-ND4 be optimized for gene therapy applications?

Allotopic expression—the nuclear transcription of genes normally transcribed inside mitochondria—represents a promising strategy for treating mitochondrial disorders caused by mutations in genes like MT-ND4. Research has demonstrated several critical factors for optimizing this approach:

• Inclusion of mitochondrial targeting sequences: The coding sequence must be associated with appropriate targeting elements to ensure efficient delivery to mitochondria. For example, research has shown success using the cis-acting elements of human COX10 mRNA, which facilitate localization to the mitochondrial surface .

• Codon optimization: The mitochondrial genetic code differs from the nuclear code, necessitating codon adjustments for nuclear expression.

• Delivery vector selection: Recombinant adeno-associated viral vectors (rAAV) have shown efficacy in delivering the human ND4 gene to retinal cells. In particular, AAV2/2 vectors administered via intravitreal injection have achieved efficient and stable transduction, with approximately 75% of retinal ganglion cells expressing the transgene 6 months post-injection .

• Expression kinetics: Studies have shown that human ND4 mRNA becomes detectable approximately 2 weeks after vector administration and remains stable for at least 14 weeks thereafter .

• Protein localization verification: Confirming proper mitochondrial targeting is essential. Immunohistochemistry studies using antibodies against epitope tags (e.g., HA1) and mitochondrial markers have demonstrated punctate cytoplasmic distribution consistent with mitochondrial localization .

These optimization strategies have produced significant therapeutic benefits in experimental models of LHON, preventing retinal ganglion cell degeneration and preserving both Complex I function in optic nerves and visual function .

What experimental designs best assess the functional integration of recombinant MT-ND4 into mitochondrial Complex I?

Assessing whether recombinantly expressed MT-ND4 properly integrates into the mitochondrial respiratory chain Complex I requires sophisticated experimental approaches:

• Co-immunoprecipitation studies: These can detect physical interactions between recombinant MT-ND4 and other Complex I subunits. Research has employed antibodies against epitope tags (such as HA1) to pull down the recombinant protein and analyze co-precipitating factors .

• Subcellular fractionation and Western blotting: This approach involves:

  • Isolating intact mitochondria from cells expressing recombinant MT-ND4

  • Further separating mitochondrial membrane fractions

  • Performing Western blot analysis with antibodies against the recombinant protein and known Complex I subunits

  • Comparing relative abundance patterns to confirm co-localization

• Immunohistochemistry with co-localization analysis: Research has demonstrated the value of using dual-labeling with antibodies against:

  • Epitope tags on recombinant MT-ND4 (e.g., HA1)

  • Endogenous mitochondrial proteins (e.g., ND6, another Complex I subunit)

  Confocal microscopy analysis reveals co-localization patterns visible as yellow-orange pixels in merged images, indicating that both proteins are apposed within the same cells .

• Functional respiratory chain assays: Beyond confirming physical association, it's crucial to verify that the recombinant protein restores function. Research has shown that optimized allotopic expression can rescue respiratory chain dysfunction in fibroblasts harboring mutations in genes including ND4 .

What are the comparative advantages of using Crotalus adamanteus MT-ND4 versus human MT-ND4 in research applications?

While direct comparisons are not extensively documented in the search results, several theoretical and practical advantages can be inferred for using Crotalus adamanteus MT-ND4 in specific research contexts:

• Evolutionary insights: Snake mitochondrial proteins may exhibit structural or functional adaptations related to their unique metabolism and physiology, providing valuable comparative data for understanding the evolution of the electron transport chain.

• Structural stability: Some proteins from extremophilic organisms or those with unique physiological adaptations may exhibit enhanced stability under laboratory conditions, potentially offering advantages for structural studies.

• Antigen development: The snake version may provide useful epitopes for generating antibodies with specific characteristics or reduced cross-reactivity with human proteins in certain experimental systems.

• Expression efficiency: The Crotalus adamanteus sequence has been successfully expressed in E. coli systems, suggesting optimized codon usage or folding characteristics that facilitate recombinant production .

Researchers should evaluate these potential advantages against their specific experimental requirements, considering factors such as sequence homology to their species of interest, expression system compatibility, and the particular functional properties under investigation.

How do mutations in MT-ND4 contribute to mitochondrial diseases and what research models best represent these pathologies?

Mutations in MT-ND4 have significant implications for mitochondrial diseases, particularly Leber hereditary optic neuropathy (LHON). The search results provide insights into both the disease mechanisms and research models:

• Disease associations:

  • Approximately 70% of LHON cases result from mutations in the MT-ND4 gene, leading to central vision loss .

  • Though less common, mutations in the related MT-ND4L gene (e.g., T10663C or Val65Ala) have also been linked to LHON .

• Pathogenic mechanisms:

  • MT-ND4 mutations disrupt Complex I function, compromising electron transport and ATP production.

  • This dysfunction particularly affects retinal ganglion cells, leading to their degeneration and consequent vision loss .

• Research models:

  • Cellular models: Fibroblasts harboring MT-ND4 mutations have been used to study respiratory chain dysfunction and evaluate potential therapeutic approaches .

  • Animal models: Rat models of ND4 dysfunction in retinal ganglion cells have been generated using electroporation of mutant ND4, providing a platform for testing gene therapy approaches .

  • Gene therapy models: Studies have demonstrated that intravitreal administration of AAV2/2 vectors carrying the wild-type human ND4 gene can prevent retinal ganglion cell degeneration in experimental models of LHON .

• Detection methods:

  • The triplex real-time PCR assay, which simultaneously quantifies MT-ND4, MT-ND1, and D-Loop regions, provides a sensitive tool for detecting deletions in MT-ND4 that may contribute to disease pathology .

These findings highlight the importance of MT-ND4 in mitochondrial function and disease, while also demonstrating the potential of gene therapy approaches targeting this gene for treating conditions like LHON.