Recombinant Crotalus atrox Cytochrome b (MT-CYB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Crotalus atrox Cytochrome b

Recombinant Crotalus atrox Cytochrome b (MT-CYB) is a laboratory-synthesized version of the naturally occurring cytochrome b protein found in the Western Diamondback Rattlesnake. This protein belongs to the broader cytochrome b family, which functions as a critical component in the electron transport chain within mitochondria. The recombinant variant is produced through molecular cloning techniques, whereby the MT-CYB gene from Crotalus atrox is inserted into an expression vector and subsequently expressed in various host systems to generate functional protein for research purposes .

The gene encoding this protein is alternatively known by several nomenclature designations including MT-CYB, COB, CYTB, and MTCYB, reflecting its conserved nature across taxonomic classifications . As a component of Complex III (ubiquinol-cytochrome c reductase), Cytochrome b plays an essential role in cellular respiration, making it not only valuable for evolutionary studies but also for understanding fundamental aspects of snake metabolism and physiology.

Background on Crotalus atrox

Crotalus atrox, commonly known as the Western Diamondback Rattlesnake, is a venomous pit viper endemic to North America, particularly the southwestern United States and northern Mexico. This species has garnered significant scientific interest due to its complex venom composition and genetic diversity. Research has demonstrated that C. atrox possesses an extraordinarily large battery of snake venom metalloproteinase (SVMP) genes, with approximately 30 loci identified—far exceeding the number found in other crotalid species, which typically contain between 5 to 15 SVMP genes .

The genomic complexity of C. atrox extends beyond its venom genes. Studies examining the fetuin A-related metalloproteinase inhibitor family in C. atrox revealed a five-gene complex arranged in tandem . This genetic architecture suggests that C. atrox has undergone significant evolutionary adaptation, potentially influencing various proteins including cytochrome b.

Gene Organization and Protein Structure

Cytochrome b in C. atrox, like in other vertebrates, is encoded by the mitochondrial genome. While specific details about the MT-CYB gene structure in C. atrox are not extensively documented in the available research, comparative studies across crotalid species suggest conservation of functional domains essential for electron transport chain operations.

The MT-CYB protein functions as Complex III subunit 3 within the cytochrome b-c1 complex, serving as an integral membrane protein embedded in the inner mitochondrial membrane . Its primary function involves the transfer of electrons from ubiquinol to cytochrome c while simultaneously pumping protons across the membrane to contribute to the electrochemical gradient used for ATP synthesis.

Expression Systems

Recombinant Crotalus atrox Cytochrome b can be produced using various expression systems, each offering distinct advantages for protein production. According to technical specifications, this protein can be expressed in E. coli, yeast, baculovirus, or mammalian cell systems . The selection of an appropriate expression system depends on research requirements, desired post-translational modifications, and functional assay compatibility.

The prokaryotic E. coli system typically offers high yield and cost-effectiveness but may lack post-translational modifications that could be important for certain functional studies. Conversely, eukaryotic systems such as yeast, baculovirus, and mammalian cells provide more sophisticated processing capabilities that might better mimic the native protein configuration.

Purification and Quality Control

The purification process for recombinant MT-CYB aims to achieve a minimum purity of 85% as assessed by SDS-PAGE analysis . While specific purification protocols for C. atrox MT-CYB are not detailed in the available literature, typical approaches for membrane proteins like cytochrome b include:

  1. Cell lysis and membrane fraction isolation

  2. Detergent-based solubilization

  3. Affinity chromatography (often using polyhistidine tags)

  4. Size exclusion chromatography

  5. Purity assessment via SDS-PAGE and potentially mass spectrometry

Quality control measures typically involve not only purity assessment but also functional validation through spectroscopic analysis of the heme groups and potentially electron transfer assays.

Metabolic Functions

The primary biological function of Cytochrome b in C. atrox, as in other vertebrates, is participation in the mitochondrial electron transport chain. Specifically, it functions within Complex III (ubiquinol-cytochrome c reductase) to catalyze electron transfer from ubiquinol to cytochrome c while pumping protons across the inner mitochondrial membrane. This process contributes to the proton gradient that drives ATP synthesis through oxidative phosphorylation.

The energetic demands of venomous snakes like C. atrox, particularly during venom production, hunting, and digestion, underscore the importance of efficient mitochondrial function. The cytochrome b protein plays a crucial role in meeting these metabolic requirements.

Evolutionary Significance

Cytochrome b has been extensively used as a molecular marker in phylogenetic studies across various taxonomic groups, including reptiles. The relatively slow evolutionary rate of this mitochondrial gene makes it valuable for resolving relationships among closely related species. In the context of C. atrox, MT-CYB sequences can provide insights into:

  1. Population structure and genetic diversity within the species

  2. Evolutionary relationships among Crotalus species

  3. Divergence timing and historical biogeography of rattlesnakes

Phylogenetic and Population Studies

Recombinant MT-CYB has significant applications in evolutionary biology and taxonomy. By comparing cytochrome b sequences across different populations of C. atrox and related species, researchers can:

  • Reconstruct evolutionary histories

  • Identify cryptic species or subspecies

  • Assess genetic diversity and population structure

  • Determine conservation priorities based on genetic distinctiveness

Comparative Biochemistry

The recombinant protein also enables comparative studies of mitochondrial function across snake species. Such research can illuminate adaptations related to:

  • Metabolic rate differences between venomous and non-venomous species

  • Thermal adaptations in snakes from different habitats

  • Energetic correlates of venom production

  • Mechanistic understanding of snake mitochondrial disorders

Antibody Production and Diagnostic Applications

Recombinant C. atrox MT-CYB can serve as an antigen for antibody production, facilitating:

  • Development of specific antibodies for immunohistochemistry

  • Creation of diagnostic tools for species identification

  • Markers for tissue-specific mitochondrial content or function

  • Research reagents for investigating snake physiology

Comparison with Cytochrome b from Other Species

A comparative analysis of Cytochrome b across different crotalid species reveals both conservation of functional domains and species-specific variations. While C. atrox exhibits distinctive genomic characteristics in its venom composition, particularly with its expanded SVMP gene family , the MT-CYB gene appears to maintain the core functional elements required for electron transport.

The table below compares general characteristics of MT-CYB across selected snake species for which recombinant proteins are commercially available:

SpeciesCommon NameTaxonomic FamilyExpression SystemsApplications
Crotalus atroxWestern Diamondback RattlesnakeViperidae (Crotalinae)E. coli, Yeast, Baculovirus, MammalianPhylogenetics, Biochemistry
Bothrops atroxCommon LanceheadViperidae (Crotalinae)E. coli, Yeast, Baculovirus, MammalianComparative Venom Studies, Evolutionary Biology
Agkistrodon contortrix contortrixSouthern CopperheadViperidae (Crotalinae)E. coli, Yeast, Baculovirus, MammalianBiogeography, Species Delimitation
Bothriechis schlegeliiEyelash ViperViperidae (Crotalinae)E. coli, Yeast, Baculovirus, MammalianTropical Snake Evolution, Conservation Genetics
Elapsoidea semiannulataEast African Garter SnakeElapidaeE. coli, Yeast, Baculovirus, MammalianAfrican Snake Phylogeny

Table 2: Comparative analysis of recombinant Cytochrome b across snake species

Integration with Venom Evolution Studies

Given the extraordinary expansion of venom genes in C. atrox , future research could explore potential correlations between mitochondrial gene evolution (including MT-CYB) and venom gene diversification. Such studies might investigate whether increased metabolic efficiency through MT-CYB adaptations supports the energetically demanding process of venom production.

Functional Assays with Recombinant Protein

Development of in vitro assays using recombinant C. atrox MT-CYB could enable comparative assessment of electron transfer kinetics across different snake species. Such studies could potentially reveal functional adaptations related to the diverse ecological niches and physiological demands of various snake species.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and protein stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
MT-CYB; COB; CYTB; MTCYB; Cytochrome b; Complex III subunit 3; Complex III subunit III; Cytochrome b-c1 complex subunit 3; Ubiquinol-cytochrome-c reductase complex cytochrome b subunit; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-214
Protein Length
full length protein
Species
Crotalus atrox (Western diamondback rattlesnake)
Target Names
Target Protein Sequence
YINYKNMSHQHLLTLFNLLPVGANISTWWNFGSMLLSCLMIQIATGFFLAIHYTANINMA FSSIVHISRDVPYGWIMQNTHAIGASLFFICIYIHIARGIYYGSYLNKEVWLSGTTLLII LMATAFFGYVLPWGQMSFWAATVITNLLTAIPYLGTTLTTWLWGGFAINDPTLTRFFALH FILPFAIISLSSLHILLLHNEGSNNPLGTNSDID
Uniprot No.

Target Background

Function
Cytochrome b is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. The b-c1 complex mediates electron transfer from ubiquinol to cytochrome c. This process contributes to the generation of a proton gradient across the mitochondrial membrane, which is subsequently utilized for ATP synthesis.
Protein Families
Cytochrome b family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the significance of Crotalus atrox MT-CYB in phylogenetic studies?

Cytochrome b from Crotalus atrox serves as a valuable mitochondrial marker for investigating evolutionary relationships within Crotalinae (pit vipers). Unlike nuclear markers, MT-CYB provides insights into matrilineal patterns of genetic variation that can be used to identify divergent lineages and historical population structures. Studies combining mitochondrial data with nuclear single nucleotide polymorphisms (SNPs) offer a more powerful approach for testing population genetic hypotheses by comparing matrilineal versus whole genome patterns of variation . This has been particularly valuable in revealing the existence of eastern and western C. atrox lineages that show evidence of historical divergence followed by secondary contact.

What DNA extraction methods are most effective for isolating genomic DNA containing MT-CYB from Crotalus atrox samples?

Multiple DNA extraction methods have proven effective for isolating genomic DNA from various C. atrox tissue samples. Researchers have successfully used:

  • Qiagen DNeasy extraction kits for various tissue types

  • Zymo Research Genomic DNA Tissue MiniPrep kits for most solid tissues

  • Thermo Scientific GeneJet whole blood DNA extraction kits specifically for blood samples

  • Phenol-chloroform-isoamyl alcohol extraction for challenging samples like shed skins

The choice of extraction method depends on tissue type, sample quality, and downstream applications. For recombinant expression of MT-CYB, high molecular weight DNA with minimal degradation is preferable, making column-based methods (options 1-3) generally more suitable for most laboratory contexts.

How can I verify the authenticity of recombinant Crotalus atrox MT-CYB protein?

Authentication of recombinant C. atrox MT-CYB can be accomplished through multiple complementary approaches:

  • Sequence verification: Compare the amino acid sequence with reference sequences using mass spectrometry

  • Spectral analysis: Cytochrome b has characteristic absorption peaks at 562 nm (reduced) and 530 nm (oxidized)

  • Immunological detection: Western blotting using antibodies specific to conserved cytochrome b epitopes

  • Functional assays: Measure electron transport capability in reconstituted systems

For research applications requiring high confidence in protein identity, combining at least two of these methods is recommended to confirm both sequence accuracy and functional integrity.

What are the optimal expression systems for producing functional recombinant Crotalus atrox MT-CYB?

Expression of functional membrane proteins like cytochrome b presents significant challenges. For C. atrox MT-CYB, consider these expression systems with their respective advantages:

  • E. coli with special membrane protein expression strains (C41/C43): Provides high yield but may require refolding protocols and heme supplementation

  • Insect cell expression systems (Sf9, High Five): Offers better folding and post-translational modifications for membrane proteins

  • Cell-free expression systems with membrane mimetics: Allows direct incorporation into nanodiscs or liposomes

The choice depends on downstream applications. For structural studies, insect cell expression typically produces better-folded protein, while E. coli systems may be sufficient for antibody production or basic functional studies. Cell-free systems offer advantages when rapid screening of multiple constructs is needed.

How can I resolve the technical challenges in analyzing divergent mitochondrial haplotypes of Crotalus atrox MT-CYB?

Analysis of divergent MT-CYB haplotypes in C. atrox requires addressing several technical considerations:

  • Primer design for complete coverage: Design multiple primer pairs that account for potential polymorphic sites at primer binding regions

  • Cloning before sequencing: When heteroplasmy is suspected, clone amplicons to separate distinct haplotypes

  • Employ Next-Generation Sequencing: Use deep sequencing to detect low-frequency haplotypes

  • Haplotype network analysis: Implement statistical parsimony methods to visualize relationships between closely related haplotypes

Calculate haplotype diversity using the Nei and Tajima equation as implemented in population genetics software or custom scripts . When comparing mitochondrial and nuclear patterns of variation, be aware that mitochondrial and nuclear lineages may show discordant patterns due to different inheritance modes and historical introgression between populations.

What approaches can effectively integrate MT-CYB data with nuclear markers to reconstruct Crotalus atrox evolutionary history?

Integration of MT-CYB with nuclear markers requires sophisticated analytical approaches:

  • Restriction site associated DNA sequencing (RADseq): Generates thousands of nuclear SNPs that can be analyzed alongside MT-CYB data

  • Coalescent-based species tree methods: Accounts for gene tree/species tree discordance using software like *BEAST or SVDquartets

  • Demographic modeling: Test alternative hypotheses of divergence and gene flow using δaδi or fastsimcoal2

The combination of mitochondrial and nuclear data provides a more powerful means of testing population genetic hypotheses and comparing matrilineal versus whole genome patterns . This approach has revealed that C. atrox populations show evidence of two divergent lineages with recent gene flow between them, suggesting incipient speciation with biased gene flow.

What calibration rate should be used for molecular clock analyses of Crotalus atrox MT-CYB sequences?

For molecular clock analyses of snake mitochondrial genes including C. atrox MT-CYB, researchers typically apply a mutation rate of 0.7% per lineage per million years for the ND4 gene . When specifically working with cytochrome b:

  • Standard calibration: A similar rate range of 0.65-0.8% per lineage per million years has been employed for cytochrome b in other snake studies

  • Relative rate tests: Compare substitution rates across taxa to evaluate clock-like behavior

  • Multiple calibration points: When possible, incorporate fossil calibrations from related taxa

When implementing Bayesian Skyline Plot (BSP) coalescent models to analyze changes in effective population size through time for C. atrox lineages, partition the dataset by gene and codon position using appropriate substitution models (e.g., HKY) with a strict molecular clock for intraspecific inferences .

How can MT-CYB data elucidate historical biogeography of Crotalus atrox populations?

MT-CYB data can reveal key insights into C. atrox historical biogeography through:

  • Phylogeographic analysis: Mapping the geographic distribution of haplotypes reveals population structure

  • Demographic reconstruction: Bayesian Skyline Plot analysis of MT-CYB sequences can detect historical population expansions or contractions

  • Divergence dating: Calibrated analyses can estimate timing of population splits

  • Gene flow analysis: Integrating MT-CYB with nuclear data can identify areas of secondary contact

Studies combining mitochondrial and nuclear markers have identified two primary mitochondrial lineages in C. atrox (eastern and western) that show evidence of historical divergence followed by secondary contact and gene flow . This pattern suggests that historical geographic barriers followed by range expansions have shaped the current genetic structure of C. atrox populations.

How do amino acid substitutions in recombinant Crotalus atrox MT-CYB affect protein stability and function?

Amino acid substitutions in recombinant C. atrox MT-CYB can significantly impact protein properties:

  • Transmembrane domain substitutions: May alter membrane insertion and protein stability

  • Substitutions near heme-binding sites: Can affect redox potential and electron transfer efficiency

  • Substitutions at ubiquinone binding sites: May modify interactions with electron transport chain components

When introducing mutations for experimental purposes, consider employing molecular dynamics simulations to predict effects on protein stability before laboratory validation. Conservative substitutions (maintaining similar physicochemical properties) are recommended for initial studies to minimize disruption of protein folding.

What are the methodological approaches for investigating interactions between recombinant MT-CYB and specific inhibitors?

To investigate interactions between recombinant MT-CYB and inhibitors, consider these methodological approaches:

  • Binding assays: Surface plasmon resonance or isothermal titration calorimetry to quantify binding affinities

  • Activity inhibition studies: Measuring electron transport rates in the presence of varying inhibitor concentrations

  • Structural studies: X-ray crystallography or cryo-EM to visualize inhibitor binding sites

  • Computational docking: In silico prediction of binding modes and affinities

The structural analysis of inhibitor binding with natural and synthetic ligands, as demonstrated in studies of C. atrox metalloproteinases , provides a valuable template for investigating MT-CYB inhibitor interactions. Similar approaches can elucidate the nature of specific inhibitor binding to recombinant MT-CYB.

How can recombinant Crotalus atrox MT-CYB be used to study mitochondrial dysfunction in comparative models?

Recombinant C. atrox MT-CYB offers unique opportunities for comparative mitochondrial research:

  • Thermal stability studies: Compare function across temperature ranges relevant to ectothermic physiology

  • Oxygen affinity comparisons: Evaluate differences in oxygen binding properties between mammalian and reptilian cytochrome b

  • ROS production analysis: Measure reactive oxygen species generation under various conditions

Research on C. atrox venom-induced cellular toxicity has demonstrated robust production of reactive oxygen species (ROS) , suggesting potential comparative studies between venom effects and mitochondrial dysfunction. Pretreatment with antioxidants like polyethylene glycol (PEG)-catalase or N-acetyl cysteine (NAC) significantly reduces venom-induced oxidative stress , offering insights into potential protective mechanisms against mitochondrial ROS production.

What methodological considerations are important when comparing MT-CYB sequences across rattlesnake species for evolutionary studies?

When comparing MT-CYB sequences across rattlesnake species:

  • Alignment strategies: Use translation alignment for protein-coding genes to maintain codon positions

  • Saturation analysis: Test for substitution saturation at different codon positions before phylogenetic reconstruction

  • Model selection: Apply information criteria (AIC, BIC) to select appropriate substitution models

  • Heterogeneity assessment: Test for among-site rate variation and compositional heterogeneity

Studies of incipient speciation in C. atrox have successfully combined extensive sampling of individuals for mitochondrial genes with sampling of thousands of nuclear SNPs . This approach provides a powerful means of testing population genetic hypotheses and comparing matrilineal versus whole-genome patterns of genetic variation to characterize patterns of divergence and secondary contact.

What quality control methods ensure reliable data when working with recombinant Crotalus atrox MT-CYB?

Implement these quality control measures when working with recombinant C. atrox MT-CYB:

  • Sequence verification: Confirm the absence of PCR-induced errors through bidirectional sequencing

  • Protein purity assessment: Analyze via SDS-PAGE and size exclusion chromatography

  • Functional validation: Verify electron transport capability in reconstituted systems

  • Structural integrity: Circular dichroism to confirm proper secondary structure content

For phylogenetic applications, always include positive controls (verified C. atrox samples) and negative controls (non-template) in PCR reactions. When analyzing population data, test for the presence of nuclear mitochondrial DNA segments (numts) that could confound mitochondrial sequence analysis.

How can researchers address the challenge of heteroplasmy when analyzing Crotalus atrox MT-CYB sequences?

Heteroplasmy (multiple mitochondrial genotypes within an individual) presents special challenges:

  • Detection methods: Apply deep sequencing or cloning approaches to identify low-frequency variants

  • Quantification approaches: Digital droplet PCR to accurately determine heteroplasmy ratios

  • Data filtering: Set threshold criteria to distinguish true heteroplasmy from sequencing errors

  • Phylogenetic handling: Apply appropriate models that account for intra-individual variation

When analyzing population genetic data from C. atrox, be aware that apparent heteroplasmy could also result from numts or sample contamination. Verification through multiple tissue samples from the same individual can help distinguish true heteroplasmy from artifacts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.