Recombinant Crotalus oreganus concolor NADH-ubiquinone oxidoreductase chain 4 (MT-ND4)

Shipped with Ice Packs
In Stock

Description

Introduction to Crotalus oreganus concolor and MT-ND4

Crotalus oreganus concolor, commonly known as the Midget faded rattlesnake, is a small-bodied subspecies of the Western Rattlesnake found primarily in the Colorado Plateau region spanning eastern Utah, western Colorado, and southwestern Wyoming . This rare subspecies has become a subject of interest for conservation efforts and genetic studies due to its limited geographic distribution and specialized ecological niche.

NADH-ubiquinone oxidoreductase chain 4 (MT-ND4) is a protein encoded by the mitochondrial MT-ND4 gene, which serves as a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase, also known as Complex I . In its native context, this protein plays a crucial role in cellular energy production through oxidative phosphorylation, specifically in the transfer of electrons from NADH to ubiquinone in the respiratory chain .

The recombinant version of this protein is produced through genetic engineering techniques, typically using bacterial expression systems, to create functional protein molecules identical to those found in the organism of origin but in quantities suitable for research applications.

Genetic Information

The gene encoding MT-ND4 in Crotalus oreganus concolor is located in the mitochondrial genome. In the UniProt database, this protein is identified with the accession number O03710 . Like other mitochondrially encoded genes, MT-ND4 is transmitted through maternal inheritance and can exhibit unique evolutionary patterns compared to nuclear genes.

Role in Mitochondrial Respiration

The MT-ND4 protein serves as an essential component of Complex I (NADH:ubiquinone oxidoreductase) in the mitochondrial respiratory chain. Complex I is responsible for the first step in the electron transport process during oxidative phosphorylation, transferring electrons from NADH to ubiquinone . This electron transfer is coupled with proton pumping across the inner mitochondrial membrane, contributing to the establishment of a proton gradient that drives ATP synthesis.

Enzymatic Activity

As part of Complex I, MT-ND4 contributes to NADH dehydrogenase activity, which is crucial for energy production in cells. The enzyme catalyzes the oxidation of NADH to NAD+, transferring electrons to ubiquinone (CoQ). The reaction can be represented as:

NADH + H+ + ubiquinone → NAD+ + ubiquinol

This reaction represents a critical initial step in the cellular respiration process that ultimately leads to ATP production .

Expression Systems

The recombinant Crotalus oreganus concolor MT-ND4 protein is primarily produced in Escherichia coli expression systems . This bacterial expression platform allows for efficient production of the protein with appropriate post-translational modifications. The gene sequence encoding the full-length protein (amino acids 1-231) is typically cloned into an expression vector that includes sequences for an N-terminal His-tag to facilitate purification .

Purification and Processing

Following expression in E. coli, the recombinant protein undergoes purification processes that typically include:

  1. Cell lysis to release the expressed protein

  2. Affinity chromatography using the His-tag to selectively capture the target protein

  3. Additional purification steps as needed to achieve high purity

  4. Quality control assessment, often including SDS-PAGE analysis

The final product achieves a purity greater than 90% as determined by SDS-PAGE analysis . The purified protein is typically provided in lyophilized form for stability during shipping and storage.

Comparative Biochemical Studies

Recombinant MT-ND4 from Crotalus oreganus concolor provides a valuable tool for comparative studies of mitochondrial function across different species. By examining the structural and functional characteristics of this protein in comparison to homologs from other organisms, researchers can gain insights into evolutionary adaptations in energy metabolism.

Mitochondrial Disease Research

While direct evidence from the search results is limited, the study of MT-ND4 variants has significant implications for understanding mitochondrial diseases. In humans, mutations in MT-ND4 are associated with Leber hereditary optic neuropathy, a condition characterized by vision loss . The availability of recombinant MT-ND4 from various species enables comparative studies that may illuminate the molecular mechanisms underlying mitochondrial disorders.

Conservation Biology

The Midget faded rattlesnake (Crotalus oreganus concolor) is considered a rare subspecies requiring conservation attention. Molecular tools, including recombinant proteins and genetic markers such as microsatellite loci, contribute to population genetic analyses that inform conservation strategies . Understanding the genetic diversity and molecular biology of this species supports evidence-based management efforts.

Comparative Analysis with MT-ND4 from Other Species

The MT-ND4 protein has been characterized across multiple species, allowing for comparative analyses that reveal evolutionary relationships and functional conservation. Commercial providers offer recombinant MT-ND4 proteins from various species, including:

Table 2: Comparative Overview of MT-ND4 Proteins from Different Species

SpeciesCommon NameExpression SystemNotable Features
Crotalus oreganus concolorMidget faded rattlesnakeE. coli231 amino acids, His-tagged
Caiman crocodilusSpectacled caimanE. coli/Yeast/BaculovirusAvailable as full-length or partial protein
Tarsius syrichtaPhilippine tarsierE. coli/Yeast/BaculovirusAvailable as full-length or partial protein
Macaca fascicularisCrab-eating macaqueE. coliClosely related to human MT-ND4
Homo sapiensHumanVariousAssociated with Leber hereditary optic neuropathy

These comparative resources allow researchers to investigate evolutionary changes in the protein structure and function across diverse vertebrate lineages .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND4; MTND4; NADH4; ND4; NADH-ubiquinone oxidoreductase chain 4; NADH dehydrogenase subunit 4; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Crotalus oreganus concolor (Midget faded rattlesnake) (Crotalus viridis concolor)
Target Names
Target Protein Sequence
PIAGSMVLAAILLKLGGYGIIRMMQIFPTTKTDLFLPFIVLALWGAILANLTCLQQTDLK SLIAYSSISHMGLVVAAIIIQTPWGLSGAMALMIAHGFTSSALFCLANTTYERTHTRILI LTRGFHNILPMTTTWWLMTNLMNIAIPPSMNFTGELLIMSALFNWCPATIIMLGLSMLIT ASYSLHMFLSTQMGPTLLNSQTEPMHSREHLLITLHLAPLLMISLKPELVI
Uniprot No.

Target Background

Function
This protein is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is believed to be part of the minimal assembly required for catalysis. Complex I plays a crucial role in transferring electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Protein Families
Complex I subunit 4 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is MT-ND4 and what is its function in cellular respiration?

MT-ND4 (Mitochondrially Encoded NADH:Ubiquinone Oxidoreductase Core Subunit 4) is a protein that serves as a core component of complex I in the mitochondrial respiratory chain. It plays an essential role in the electron transport process during oxidative phosphorylation. Specifically, MT-ND4 contributes to the first step of electron transport, transferring electrons from NADH to ubiquinone .

The protein enables NADH dehydrogenase (ubiquinone) activity and is involved in mitochondrial electron transport from NADH to ubiquinone. MT-ND4 also participates in mitochondrial respiratory chain complex I assembly, serving as a critical structural and functional component . The enzyme complex containing MT-ND4 catalyzes reactions that drive ATP production by creating an unequal electrical charge across the inner mitochondrial membrane through step-by-step electron transfer .

In rattlesnake species like Crotalus oreganus concolor, MT-ND4 maintains the same fundamental enzymatic function but may exhibit species-specific structural variations that can be valuable for comparative studies of mitochondrial function and evolution.

What are the storage and handling requirements for recombinant MT-ND4 protein?

Proper storage and handling of recombinant Crotalus oreganus concolor MT-ND4 protein is critical for maintaining its structural integrity and functional activity. The shelf life of this protein is affected by multiple factors including storage state, buffer ingredients, storage temperature, and the intrinsic stability of the protein itself .

For liquid formulations, the recommended storage is at -20°C or -80°C, where the protein typically maintains stability for up to 6 months. Lyophilized forms exhibit greater stability, with a shelf life of approximately 12 months when stored at -20°C or -80°C .

Key handling considerations include:

  • Brief centrifugation of the vial prior to opening to ensure contents settle at the bottom

  • Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Addition of glycerol (5-50% final concentration) for long-term storage

  • Aliquoting the reconstituted protein to minimize freeze-thaw cycles

  • Avoiding repeated freezing and thawing, which significantly compromises protein integrity

  • Storage of working aliquots at 4°C for no more than one week

These handling protocols are essential for ensuring experimental reproducibility and reliable results when working with this recombinant protein.

How is purity assessed for recombinant MT-ND4 preparations?

The purity assessment of recombinant Crotalus oreganus concolor MT-ND4 is primarily conducted using sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE), with commercial preparations typically achieving >85% purity . This analytical technique separates proteins based on molecular weight, allowing visualization of the target protein band and any contaminants.

For comprehensive purity assessment, researchers should implement a multi-method approach:

  • SDS-PAGE analysis: Primary method that reveals the presence of protein contaminants of different molecular weights

  • Western blotting: Confirms identity and estimates relative abundance using specific antibodies

  • Size exclusion chromatography (SEC): Detects aggregates and provides information about oligomeric state

  • Mass spectrometry: Offers precise molecular weight determination and can identify post-translational modifications

When evaluating commercially available recombinant MT-ND4, researchers should review the certificate of analysis, which typically includes a densitometric scan of SDS-PAGE results quantifying the percentage purity. For applications requiring exceptionally high purity, additional purification steps such as affinity chromatography or ion exchange chromatography may be necessary to exceed the standard 85% purity threshold.

How can researchers evaluate MT-ND4 interactions with potential inhibitors?

Evaluating MT-ND4 interactions with potential inhibitors requires sophisticated experimental approaches that assess both binding affinity and functional consequences. Based on methodologies used in related research on NADH-ubiquinone oxidoreductase inhibitors, several techniques prove particularly valuable .

Photoaffinity labeling represents a powerful approach for probing inhibitor binding sites. This technique employs photoreactive derivatives of known inhibitors that form covalent bonds with the protein upon UV irradiation. For example, in studies of Na+-NQR (a related enzyme), researchers created photoaffinity derivatives with varying spacer lengths connecting the inhibitory group to the photoreactive moiety, allowing identification of specific interaction sites .

Inhibition assays provide quantitative measurements of inhibitor potency. The half-maximal inhibitory concentration (IC50) serves as a standard metric, with more potent compounds exhibiting lower values. For instance, aurachin D-42 demonstrated remarkable potency against Na+-NQR with an IC50 of approximately 2 nM, while its derivative PAD-3 showed comparable activity at 7.0 ± 0.8 nM .

Competitive binding studies assess whether inhibitors compete for the same binding site. Researchers can evaluate if UQ (ubiquinone) affects inhibitor binding by measuring changes in inhibitor labeling in the presence of UQ. As observed in previous studies, the addition of UQ1 (50 μM) reduced inhibitor labeling by approximately 10-20%, suggesting partial competitive binding .

Enzyme kinetics under turnover conditions reveal mechanistic insights. The addition of both NADH and UQ creates turnover conditions that can significantly alter inhibitor binding or labeling efficacy, potentially due to conformational changes in the enzyme. This approach helps distinguish between inhibitors that target the static protein versus those affected by dynamic structural changes during catalysis .

What methodological approaches are used to study MT-ND4's role in disease models?

MT-ND4 has been implicated in several human diseases, including Leber hereditary optic neuropathy, making it a valuable target for disease modeling and therapeutic development. Multiple methodological approaches can be employed to investigate its role in disease states:

Genetic analysis identifies disease-associated variants in MT-ND4. Several mutations in the MT-ND4 gene are known to cause Leber hereditary optic neuropathy, an inherited form of vision loss . Sequencing techniques can be used to identify these variants in patient samples and recapitulate them in experimental models.

Functional assays assess the impact of mutations on enzyme activity. Researchers can measure NADH oxidation rates, electron transfer efficiency, and ATP production in systems expressing wild-type versus mutant MT-ND4 to determine how specific alterations affect mitochondrial function.

Cell-based models examine MT-ND4 in a cellular context. Techniques such as cybrid technology, which fuses platelets or enucleated cells containing mitochondria from patients with cell lines lacking mitochondrial DNA, allow investigation of MT-ND4 mutations in controlled nuclear backgrounds.

Animal models provide in vivo insights. While direct knockouts of mitochondrial genes are challenging, researchers can use approaches such as:

  • Heteroplasmic mouse models containing mixed populations of wild-type and mutant mitochondrial DNA

  • Conditional expression systems for studying MT-ND4 variants

  • Gene editing techniques adapted for mitochondrial targets

Pharmacological studies test potential therapeutic interventions. Using inhibitors or activators of complex I, researchers can assess whether modulating MT-ND4 function alleviates disease phenotypes in model systems.

How does recombinant MT-ND4 differ from the native protein in functional assays?

Recombinant MT-ND4 from Crotalus oreganus concolor, typically produced in E. coli expression systems , exhibits several important differences from the native protein that researchers must consider when designing functional assays:

Post-translational modifications (PTMs): Native MT-ND4 undergoes specific PTMs within mitochondria that may be absent in recombinant versions produced in bacterial systems. These differences can affect protein folding, stability, and function in experimental contexts.

Protein folding environment: Mitochondrial proteins naturally fold within the unique biochemical environment of the mitochondria, which prokaryotic expression systems cannot replicate. This can lead to subtle structural differences in the recombinant protein.

Complex formation: In its native state, MT-ND4 functions as part of the larger complex I structure, interacting with numerous other protein subunits. Recombinant MT-ND4 is typically studied in isolation or in reconstituted systems that may not perfectly recapitulate these interactions.

Membrane integration: As a component of the inner mitochondrial membrane, native MT-ND4 exists in a lipid environment that affects its conformation and activity. Recombinant versions may require specific detergents or lipid reconstitution to achieve similar functional states.

To address these limitations, researchers should:

  • Validate recombinant protein function using established activity assays that measure NADH dehydrogenase activity

  • Compare results with isolated mitochondrial preparations when possible

  • Consider reconstitution of recombinant MT-ND4 into liposomes or nanodiscs to better approximate the native membrane environment

  • Use complementary approaches such as heterologous expression in eukaryotic systems for critical experiments

What are the optimal conditions for reconstitution and stabilization of recombinant MT-ND4?

Optimal reconstitution and stabilization of recombinant Crotalus oreganus concolor MT-ND4 requires careful attention to buffer composition, protein concentration, and storage conditions. Based on empirical data, the following protocol maximizes protein stability and activity:

  • Initial reconstitution: Centrifuge the lyophilized protein vial briefly before opening, then reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Buffer optimization: For functional studies, reconstitute in a buffer containing:

    • 50 mM Tris-HCl, pH 7.5

    • 100 mM NaCl

    • 0.1 mM EDTA

    • 1 mM DTT (to maintain reduced state of critical cysteine residues)

  • Glycerol addition: Add glycerol to a final concentration of 5-50% for cryoprotection during storage, with 50% being the commonly used default concentration .

  • Aliquoting strategy: Divide the reconstituted protein into small working aliquots (typically 10-50 μL) to avoid repeated freeze-thaw cycles.

  • Storage temperature hierarchy:

    • Long-term storage: -80°C (preferred) or -20°C

    • Medium-term storage (1-3 months): -20°C

    • Short-term storage (≤1 week): 4°C

  • Stability enhancers: Consider adding one or more of the following stabilizing agents for particularly sensitive applications:

    • 0.1% bovine serum albumin

    • 1-5 mM β-mercaptoethanol

    • Protease inhibitor cocktail

  • Reconstitution in lipid environments: For functional studies requiring membrane-like conditions, consider reconstituting the protein in:

    • Detergent micelles (0.1% DDM or 0.5% CHAPS)

    • Liposomes composed of phosphatidylcholine and phosphatidylethanolamine

    • Nanodiscs with defined lipid composition

Adherence to these guidelines significantly improves experimental reproducibility and extends the functional lifetime of the recombinant protein.

How can researchers validate the functional activity of recombinant MT-ND4?

Validating the functional activity of recombinant MT-ND4 requires multiple complementary approaches to ensure the protein exhibits native-like enzymatic properties. Based on established methodologies for NADH-ubiquinone oxidoreductase components, the following validation strategy is recommended:

Spectrophotometric NADH oxidation assay:

  • Measure the decrease in NADH absorbance at 340 nm over time

  • Reaction mixture contains recombinant MT-ND4, ubiquinone (50-100 μM), and NADH (100-200 μM)

  • Calculate activity as nmol NADH oxidized per minute per mg protein

  • Compare with established reference values for NADH dehydrogenase activity

Electron transfer capacity assessment:

  • Utilize artificial electron acceptors such as ferricyanide

  • Monitor reduction rates under varying substrate concentrations

  • Determine Michaelis-Menten kinetic parameters (Km and Vmax)

Inhibitor sensitivity profile:

  • Test sensitivity to known complex I inhibitors (e.g., rotenone, piericidin A)

  • Generate dose-response curves and calculate IC50 values

  • Compare inhibition patterns with native enzyme preparations

Reconstitution studies:

  • Incorporate recombinant MT-ND4 into artificial membrane systems

  • Assess proton pumping ability using pH-sensitive fluorescent dyes

  • Measure membrane potential generation using potential-sensitive probes

Binding assays:

  • Evaluate direct binding to ubiquinone using isothermal titration calorimetry

  • Determine binding affinity (Kd) and stoichiometry

  • Compare with published values for related NADH-ubiquinone oxidoreductases

A functionally active recombinant MT-ND4 should demonstrate concentration-dependent NADH oxidation activity, appropriate response to known inhibitors, and the ability to interact with ubiquinone with affinity in the micromolar range. Multiple validation approaches increase confidence in the functional integrity of the recombinant protein.

How does MT-ND4 from Crotalus oreganus concolor compare with human MT-ND4 in structure and function?

MT-ND4 from Crotalus oreganus concolor (Midget faded rattlesnake) and human MT-ND4 exhibit both important similarities and distinct differences that researchers should consider when using the rattlesnake protein as a model or comparative system:

Structural similarities:
Both proteins function as core subunits of mitochondrial respiratory chain complex I and catalyze electron transfer from NADH to ubiquinone . They share the fundamental NADH dehydrogenase (ubiquinone) activity that enables the initial electron transport step in oxidative phosphorylation .

Functional conservation:
The basic catalytic mechanism appears conserved, with both proteins participating in complex I assembly and contributing to the creation of the electrochemical gradient necessary for ATP production . Both are integrated into the inner mitochondrial membrane and interact with other complex I components.

Evolutionary divergence:
Snake MT-ND4 has evolved under different selective pressures than human MT-ND4, potentially resulting in adaptive changes to accommodate the poikilothermic physiology of reptiles. This may include adaptations for function across wider temperature ranges.

Biomedical implications:
Human MT-ND4 mutations are associated with Leber hereditary optic neuropathy and may play roles in other conditions including Parkinson's disease, macular degeneration, schizophrenia, and serve as a biomarker for Alzheimer's disease . The snake MT-ND4 is not associated with these specific human pathologies but may offer insights into basic mechanisms of mitochondrial function relevant to these conditions.

Research applications:
Comparative studies between human and rattlesnake MT-ND4 can illuminate fundamental aspects of protein structure-function relationships and evolutionary adaptations in mitochondrial respiratory systems. The recombinant rattlesnake protein may also serve as an alternative research tool when human mitochondrial proteins are difficult to express or purify.

Understanding these similarities and differences is essential for researchers designing comparative studies or using the rattlesnake protein as a model system for investigating general principles of NADH-ubiquinone oxidoreductase function.

What techniques can be used to study MT-ND4 interactions with microtubules and tubulin?

Recent research has revealed unexpected interactions between snake venom components and microtubule networks, suggesting potential novel research directions for studying MT-ND4 interactions with tubulin. Drawing from methodologies used to study myotoxin-3 from Crotalus oreganus oreganus, the following techniques can be adapted for investigating MT-ND4-tubulin interactions:

In vitro tubulin polymerization assays:
Monitor tubulin polymerization kinetics in the presence of recombinant MT-ND4 using turbidity measurements at 350 nm. This approach can detect whether MT-ND4 enhances or inhibits microtubule formation, similar to how myotoxin-3 was found to increase tubulin polymerization .

Binding affinity determination:
Quantify direct binding between MT-ND4 and tubulin using techniques such as:

  • Surface plasmon resonance (SPR) to determine association/dissociation kinetics

  • Isothermal titration calorimetry (ITC) for measuring binding thermodynamics

  • Microscale thermophoresis (MST) for determining equilibrium dissociation constants (Kd)

The binding parameters can be compared with known tubulin-binding peptides like myotoxin-3, which binds to tubulin heterodimers with a Kd of 5.3 μM and a stoichiometry of two peptide molecules per tubulin dimer .

Fluorescence microscopy of microtubule networks:
Visualize the effects of MT-ND4 on cellular microtubule organization using immunofluorescence techniques. This approach can reveal whether MT-ND4 induces microtubule remodeling similar to the effects observed with myotoxin-3 on U87 cells .

Microtubule dynamic instability measurements:
Employ live-cell imaging with fluorescently labeled tubulin to assess how MT-ND4 affects microtubule dynamic instability parameters (growth rate, shrinkage rate, catastrophe frequency, rescue frequency). This technique was successfully used to demonstrate that myotoxin-3 decreased MCF-7 microtubule dynamic instability .

Cell penetration studies:
Determine if MT-ND4, like myotoxin-3, possesses cell-penetrating properties using fluorescently labeled protein and confocal microscopy to track cellular uptake and intracellular distribution .

Cell viability assays:
Assess the effects of MT-ND4 on cancer cell lines such as U87 glioblastoma and MCF7 breast carcinoma cells using MTT or similar viability assays, comparing results with the slight viability reduction observed with myotoxin-3 .

These techniques would help establish whether MT-ND4 from Crotalus oreganus concolor shares the unexpected tubulin-modulating properties discovered in other snake venom components, potentially opening new research avenues for anti-microtubule agents.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.