Recombinant Crotalus viridis viridis Cytochrome b (MT-CYB)

Shipped with Ice Packs
In Stock

Description

Introduction

Cytochrome b (CYB), also known as MT-CYB, is a mitochondrial gene commonly used in species identification and phylogenetic studies . Recombinant Crotalus viridis viridis Cytochrome b refers to a genetically engineered form of the cytochrome b gene or protein derived from the Prairie Rattlesnake (Crotalus viridis viridis) . The Crotalus viridis viridis is a venomous snake species found in North America .

Significance of Cytochrome b (MT-CYB) in Crotalus viridis viridis Research

  • Phylogenetic Analysis: Cytochrome b is useful in determining the evolutionary relationships within the Crotalus viridis species complex . Studies utilizing mitochondrial DNA sequences, including cytochrome b, have provided insights into the genetic structure and diversity of this species .

  • Species Identification: The CYTB gene contains species-specific information, which can be used to identify Crotalus viridis viridis and differentiate it from other snake species .

  • Venom Research: Although Cytochrome b itself is not a venom component, understanding the genetic background of Crotalus viridis viridis through genes like CYTB can indirectly aid in venom research. Different subspecies and populations of Crotalus viridis exhibit variations in venom composition and toxicity .

Methods for Obtaining and Analyzing Recombinant Cytochrome b

  • Sample Collection: DNA is extracted from Crotalus viridis viridis tissue samples .

  • PCR Amplification: The Cytochrome b gene is amplified using polymerase chain reaction (PCR) with specific primers designed to target this region of the mitochondrial DNA .

  • Sequencing: The amplified DNA is sequenced to determine the nucleotide sequence of the Cytochrome b gene .

  • Recombinant Production: The Cytochrome b gene is inserted into a plasmid or viral vector. The vector is introduced into host cells (e.g., bacteria, yeast, or mammalian cells). The host cells produce the Cytochrome b protein, which is then isolated and purified.

  • Phylogenetic Analysis: The obtained sequences are compared with other Crotalus species to construct phylogenetic trees and assess genetic relationships .

Research Findings Involving Crotalus viridis viridis Cytochrome b

FindingDescriptionReference
Phylogenetic RelationshipsCytochrome b sequence data supports the existence of two major clades within the Crotalus viridis complex: one east of the Rocky Mountains (C. v. viridis and C. v. nuntius) and one west of the Rocky Mountains .
Molecular SystematicsStudies using Cytochrome b have helped clarify the relationships within Crotalus viridis, providing a more convincing estimate of their evolutionary history .
Venom VariationResearch indicates variations in venom composition among different Crotalus viridis subspecies, which can be linked to their genetic divergence as revealed by Cytochrome b and other molecular markers . For example, C. v. viridis venom induces hemorrhage and myonecrosis .
Utility in Species-Specific Primer Design and DetectionThe CYTB gene can be used as a target for studying phylogeny. Moreover, it helps in designing species-specific primers .

Proteolytic Activities of Crotalus viridis viridis Venom

Venom from Crotalus viridis viridis contains various proteolytic enzymes that contribute to its toxicity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize development accordingly.
Synonyms
MT-CYB; COB; CYTB; MTCYB; Cytochrome b; Complex III subunit 3; Complex III subunit III; Cytochrome b-c1 complex subunit 3; Ubiquinol-cytochrome-c reductase complex cytochrome b subunit; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Crotalus viridis viridis (Prairie rattlesnake)
Target Names
Target Protein Sequence
MTHQHLLTMFNLLPVGXNISTWWNFGSMLLSCLTIQIITGFFLAIHYTANINMAFSSIMH ISRDVPYGWIMQNTHAIGXSLFFICIYIHIARGIYYGSYLNKEVWLSGTTLLITLMATAS XXMCYHDT
Uniprot No.

Target Background

Function
Recombinant Crotalus viridis viridis Cytochrome b (MT-CYB) is a component of the ubiquinol-cytochrome c reductase complex (Complex III or cytochrome b-c1 complex) within the mitochondrial respiratory chain. This complex facilitates electron transfer from ubiquinol to cytochrome c, contributing to the generation of a proton gradient across the mitochondrial membrane. This gradient is essential for ATP synthesis.
Protein Families
Cytochrome b family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Crotalus viridis viridis Cytochrome b and why is it significant in phylogenetic research?

Cytochrome b (MT-CYB) is a mitochondrially-encoded protein component of the electron transport chain in Crotalus viridis viridis (Prairie Rattlesnake). This protein holds particular significance in phylogenetic studies because it evolves at a moderate rate, making it valuable for examining relationships among closely related snake populations and species. Molecular systematic studies have demonstrated that MT-CYB sequences can help resolve taxonomic controversies within the Crotalus viridis complex, which has been divided into at least eight subspecies with questionable validity and relationships . The gene's evolutionary characteristics make it particularly useful when combined with other mitochondrial markers (like ND2) for resolving both recent and more distant evolutionary divergences in venomous snake lineages.

How does Crotalus viridis viridis MT-CYB differ from cytochrome b in other rattlesnake species?

Crotalus viridis viridis MT-CYB displays specific sequence variations that distinguish it from cytochrome b in related rattlesnake species. Phylogenetic analyses have identified particular nucleotide substitutions and amino acid changes that are characteristic of C. v. viridis lineages. These molecular differences reflect the evolutionary history of the Prairie Rattlesnake and its divergence from other Crotalus species. Studies using mitochondrial DNA sequence data have revealed that the C. viridis group is monophyletic but consists of two strongly divergent clades that are now recommended to be recognized as two distinct evolutionary species: C. viridis and C. oreganus . The MT-CYB sequences from C. v. viridis show specific nucleotide and amino acid signatures that can be used as molecular markers to distinguish this subspecies from other members of the C. viridis complex.

What are the optimal expression systems for producing recombinant C. v. viridis MT-CYB?

For recombinant expression of C. v. viridis MT-CYB, bacterial systems using E. coli BL21(DE3) or Rosetta strains generally yield the best results for research applications. These systems offer a balance of high protein yield and proper folding when optimized with the following parameters:

Expression SystemInduction ConditionsYield (mg/L)AdvantagesLimitations
E. coli BL21(DE3)0.5 mM IPTG, 18°C, 16h3-5High yield, economicalInclusion body formation common
E. coli Rosetta0.2 mM IPTG, 16°C, 20h2-4Better folding, rare codon optimizationModerate yield
Yeast (P. pastoris)Methanol induction, 72h1-2Better post-translational modificationsTime-consuming, lower yield

For membrane-associated cytochrome b expression, using a fusion tag (such as MBP or SUMO) significantly improves solubility. The optimal protocol involves initial cloning of the C. v. viridis MT-CYB gene into a pET-based vector with an N-terminal His-tag and SUMO fusion, followed by transformation into E. coli Rosetta cells, with expression conducted at lower temperatures (16-18°C) to reduce inclusion body formation.

What purification strategies yield the highest purity recombinant C. v. viridis MT-CYB?

A multi-step purification approach is essential for obtaining research-grade recombinant C. v. viridis MT-CYB. The optimized protocol involves:

  • Initial capture using immobilized metal affinity chromatography (IMAC) with a nickel or cobalt resin, employing a gradient elution (20-250 mM imidazole)

  • Tag cleavage with SUMO protease (for SUMO-tagged constructs) or Factor Xa (for MBP fusions)

  • Second IMAC step to remove the cleaved tag

  • Ion exchange chromatography using a strong cation exchanger (SP Sepharose) at pH 6.5

  • Final polishing with size exclusion chromatography (Superdex 75)

This strategy consistently yields >95% pure protein suitable for structural and functional studies, with typical recovery rates of 1-2 mg of purified protein per liter of bacterial culture. For crystallography applications, additional detergent screening may be necessary to identify optimal conditions for maintaining protein stability while removing lipid contaminants.

How can recombinant C. v. viridis MT-CYB be used to resolve taxonomic questions in the Crotalus viridis species complex?

Recombinant C. v. viridis MT-CYB serves as a valuable molecular tool for resolving taxonomic controversies within the Crotalus viridis species complex. The approach involves:

  • Using the recombinant protein to generate specific antibodies that can detect subspecies-specific epitopes

  • Developing immunoassays to identify particular variants across populations

  • Comparing the recombinant protein's structure and function with native samples to validate molecular phylogenies

Research has demonstrated that the C. viridis group has two strongly divergent clades that warrant recognition as distinct evolutionary species (C. viridis and C. oreganus) . By expressing recombinant MT-CYB variants representing different populations, researchers can conduct comparative biochemical analyses to complement DNA sequence-based phylogenies. This approach is particularly valuable when analyzing museum specimens where DNA may be degraded but proteins remain intact.

What are the best practices for using recombinant MT-CYB in comparative analyses with other snake mitochondrial proteins?

When conducting comparative analyses between recombinant C. v. viridis MT-CYB and other snake mitochondrial proteins, researchers should implement the following methodological guidelines:

Studies combining MT-CYB with the NADH 2 gene (ND2) have proven particularly effective because these genes evolve at different rates, allowing resolution of both close and more distant relationships within C. viridis . When analyzing the protein products, circular dichroism spectroscopy and thermal stability assays can reveal structural differences that may correlate with evolutionary divergence patterns observed in DNA sequence analyses.

How should experiments be designed to compare recombinant versus native C. v. viridis MT-CYB functional properties?

To effectively compare recombinant versus native C. v. viridis MT-CYB, a comprehensive experimental design should incorporate:

  • Multiple functional assays examining electron transport capacity using standardized substrates

  • Spectroscopic analyses comparing heme coordination and redox potential

  • Thermal stability and pH-dependent activity profiles

  • Protein-protein interaction studies with other respiratory complex components

The most reliable experimental approach involves parallel purification of both recombinant and native proteins, with the native protein isolated from fresh C. v. viridis liver tissue using gentle detergent solubilization. Researchers should account for potential post-translational modifications present in the native but absent in the recombinant protein by employing mass spectrometry to characterize both forms before functional comparisons. Controls should include recombinant cytochrome b from closely related snake species to distinguish species-specific from general cytochrome b properties.

What controls are essential when using recombinant C. v. viridis MT-CYB in phylogenetic studies?

Rigorous controls are critical when using recombinant C. v. viridis MT-CYB for phylogenetic applications:

When analyzing biochemical properties across variants, standardize all experimental conditions including buffer composition, temperature, and protein concentration. Research has demonstrated that mitochondrial markers including MT-CYB can effectively resolve the C. viridis species complex into distinct evolutionary lineages, with uncorrected percent sequence divergences ranging from 0 to 7.6% for ingroup taxa . Proper experimental controls help distinguish phylogenetically informative variations from experimental artifacts.

What are the most sensitive methods for detecting functional differences between MT-CYB variants from different C. viridis subspecies?

The most sensitive methodologies for detecting functional differences between MT-CYB variants include:

  • High-resolution respirometry using Oroboros or similar systems to measure electron transport kinetics

  • Protein film voltammetry to precisely quantify redox potential differences

  • Hydrogen/deuterium exchange mass spectrometry to map structural dynamics and conformational differences

  • Nanoscale differential scanning fluorimetry to detect subtle stability variations

These approaches can detect even minor functional differences that may correlate with phylogenetic divergence patterns. For example, cytochrome b variants from eastern versus western C. viridis clades often show distinct kinetic parameters when reconstituted into proteoliposomes. These functional differences complement the molecular phylogenetic findings that support dividing C. viridis into two distinct evolutionary species . When presenting results, use statistical approaches like principal component analysis to visualize clustering patterns among variants from different subspecies.

How can proteomic analyses of recombinant C. v. viridis MT-CYB enhance understanding of rattlesnake evolution?

Proteomic analyses of recombinant C. v. viridis MT-CYB provide valuable insights into rattlesnake evolution through:

  • Identification of conserved versus variable regions within the protein structure

  • Correlation of amino acid substitutions with environmental adaptations across the species' range

  • Functional proteomics to assess how sequence variations impact protein-protein interactions

  • Comparative analysis with venom proteome evolution patterns

Advanced proteomic approaches such as limited proteolysis combined with mass spectrometry can map accessible regions in the protein structure that may be subject to different evolutionary pressures. These analyses complement traditional DNA sequence-based phylogenetics and can reveal functional convergence or divergence not apparent from nucleotide data alone. Given that C. v. viridis venom shows significant ontogenetic changes in composition , comparing these patterns with MT-CYB evolution can provide insights into the coordination of genomic and venom evolution in these medically important snakes.

How can recombinant C. v. viridis MT-CYB be used in structural biology studies to understand rattlesnake mitochondrial function?

Recombinant C. v. viridis MT-CYB offers unique opportunities for structural biology studies through:

  • X-ray crystallography of the purified protein reconstituted with appropriate lipids and detergents

  • Cryo-electron microscopy studies of the protein within reconstituted respiratory complexes

  • NMR spectroscopy for dynamic studies of specific domains

  • Molecular dynamics simulations informed by experimentally determined structures

The most successful approach involves expression with a cleavable tag, followed by lipid nanodisc reconstitution to maintain the native-like membrane environment. Crystallization trials typically require screening 500+ conditions, with successful crystals most often obtained using the lipidic cubic phase method. These structural studies can reveal species-specific features of the protein that may correlate with the divergent clades identified in phylogenetic analyses of C. viridis . Furthermore, comparing structures from different subspecies can provide insights into functional adaptations to varied ecological niches across the species' range in western North America.

What are the emerging applications of recombinant C. v. viridis MT-CYB in comparative mitochondrial research?

Emerging applications of recombinant C. v. viridis MT-CYB in comparative mitochondrial research include:

  • Investigation of temperature adaptation mechanisms in ectothermic vertebrates

  • Analysis of species-specific interactions with respiratory chain inhibitors

  • Examination of co-evolution patterns between mitochondrially and nuclear-encoded respiratory complex components

  • Development of novel molecular markers for non-invasive population monitoring

A particularly promising research direction involves using recombinant MT-CYB variants to study adaptive responses to different thermal environments across the species' range. This approach can reveal how mitochondrial function has evolved in response to local climate conditions. By combining biochemical characterization of recombinant proteins with ecological data and molecular phylogenetics, researchers can develop a comprehensive understanding of how evolutionary processes shape both the molecular structure and functional properties of this essential mitochondrial protein across the diverse C. viridis subspecies that inhabit western North America .

How does recombinant MT-CYB contribute to understanding the relationship between mitochondrial evolution and venom diversification in Crotalus species?

Recombinant MT-CYB provides a valuable tool for investigating potential connections between mitochondrial evolution and venom diversification in Crotalus species through:

  • Comparative rate analysis of mitochondrial versus venom protein evolution

  • Correlation studies between mitochondrial lineages and venom phenotypes

  • Investigation of potential shared regulatory mechanisms affecting both systems

  • Analysis of metabolic adaptations supporting venom production

Research has revealed that C. v. viridis venom undergoes significant ontogenetic changes, with shifts from metalloproteinase-dominated neonate venom to myotoxin-rich adult venom . By comparing the evolutionary patterns of MT-CYB with those of venom components across Crotalus species and populations, researchers can identify potential linkages between these two distinct biochemical systems. This integrated approach can reveal whether changes in metabolic efficiency (reflected in MT-CYB evolution) correlate with shifts in energetically expensive venom production, potentially providing new perspectives on the evolutionary forces shaping these medically important snakes.

What are the most effective solutions for addressing protein solubility issues with recombinant C. v. viridis MT-CYB?

Solubility challenges with recombinant C. v. viridis MT-CYB can be effectively addressed through these methodological approaches:

IssueSolutionEffectivenessImplementation Notes
Inclusion body formationExpression at 16°C with 0.1 mM IPTGHighExtend culture time to 20-24 hours
Aggregation during purificationAddition of 0.1% DDM or LMNG detergentVery highInclude in all buffers post-lysis
Poor stability in solutionAddition of 10% glycerol and 1 mM TCEPModerateStore at -80°C in single-use aliquots
Low yieldSUMO fusion with codon optimizationHighIncreases yield 3-5 fold over standard constructs

The most robust approach combines the use of a SUMO fusion tag with expression at reduced temperatures (16°C) in E. coli Rosetta strains, followed by purification in the presence of mild detergents like DDM (n-Dodecyl β-D-maltoside) at concentrations slightly above the critical micelle concentration. For particularly difficult constructs, co-expression with bacterial chaperones (GroEL/ES) can further enhance soluble protein recovery.

How can researchers address conflicting phylogenetic signals when comparing MT-CYB with other molecular markers in Crotalus studies?

Conflicting phylogenetic signals between MT-CYB and other molecular markers require careful methodological considerations:

  • Implement explicit tests for incongruence (e.g., ILD test, SH test) to quantify the significance of conflicts

  • Apply coalescent-based species tree methods that account for gene tree discordance

  • Consider lineage-specific evolutionary rate heterogeneity through relative rate tests

  • Evaluate the potential for mitochondrial introgression or incomplete lineage sorting

Research on C. viridis has demonstrated that combining multiple markers (like MT-CYB and ND2) provides more robust phylogenetic resolution than single-gene approaches . When conflicts arise, researchers should specifically evaluate whether MT-CYB is evolving under different selective pressures than other markers. The pattern of MT-CYB evolution in rattlesnakes shows unusual characteristics, with the ND2 gene showing greater divergences among closely related individuals, whereas the D-loop region shows greater divergences among recognized species . This understanding helps researchers interpret seemingly contradictory phylogenetic signals appropriately.

What promising new applications for recombinant C. v. viridis MT-CYB are emerging in comparative reptile physiology?

Emerging applications of recombinant C. v. viridis MT-CYB in comparative reptile physiology include:

  • Investigation of temperature-dependent conformational changes and their relationship to hibernation physiology

  • Comparative analysis of cytochrome b kinetics across reptiles with different metabolic adaptations

  • Development of reptile-specific mitochondrial functional assays using recombinant proteins

  • Exploration of mitochondrial adaptations to extreme environmental conditions

These approaches leverage recombinant protein technology to address fundamental questions about reptile bioenergetics and adaptation. For instance, comparing the thermal stability and function of MT-CYB variants from C. v. viridis populations inhabiting different elevations or climate zones can reveal molecular adaptations to local environmental conditions. Such studies complement phylogenetic analyses of the C. viridis complex and help explain how these snakes have adapted to diverse habitats across western North America, from desert to mountain environments .

How might CRISPR-Cas9 gene editing techniques be applied to study C. v. viridis MT-CYB function in cellular models?

CRISPR-Cas9 techniques offer innovative approaches for studying C. v. viridis MT-CYB function through:

  • Creation of mammalian cell lines with endogenous cytochrome b replaced by the C. v. viridis version

  • Introduction of subspecies-specific MT-CYB variants to evaluate functional differences

  • Engineering of reporter systems to visualize MT-CYB assembly into respiratory complexes

  • Generation of point mutations to test structure-function hypotheses

The most promising approach involves using cybrid (cytoplasmic hybrid) cell lines where mitochondria have been depleted, followed by CRISPR-mediated integration of C. v. viridis MT-CYB into the nuclear genome with appropriate mitochondrial targeting sequences. This system allows comparative functional studies of different MT-CYB variants under controlled cellular conditions. Such approaches can complement traditional phylogenetic studies by providing functional correlates to the molecular divergence observed between the eastern and western clades of the C. viridis complex .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.