Recombinant Crucihimalaya wallichii Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to your needs.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Crucihimalaya wallichii (Rock-cress) (Arabidopsis campestris)
Target Names
petA
Target Protein Sequence
YPIFAQQNYENPREATGRIVCANCHLANKPVDIEVPQTVLPDTVFEAVVKIPYDMQLKQV LANGKKGALNVGAVLILPEGFELAPPDRISPEMKEKIGNLSFQNYRPNKKNILVIGPVPG QKYSEITFPILAPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAGGIIS KILRKEKGGYEITIVDASNGREVIDIIPRGLELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFLGSVVLAQIFLVLKKKQFEKVQLSEMNF
Uniprot No.

Target Background

Function

Crucihimalaya wallichii Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex mediates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), facilitates cyclic electron flow around PSI, and participates in state transitions.

Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f and what role does it play in photosynthesis?

Apocytochrome f is the protein backbone of cytochrome f, a crucial component of the cytochrome b6f complex that mediates electron transfer between photosystem II and photosystem I in the photosynthetic electron transport chain. The mature cytochrome f forms after the covalent attachment of a heme group to the apocytochrome. In Crucihimalaya wallichii, as in other photosynthetic organisms, this protein is essential for energy conversion during photosynthesis, participating in generating the proton gradient across the thylakoid membrane that drives ATP synthesis. Recombinant forms of this protein allow researchers to study its structure-function relationships outside of its native context .

How does Crucihimalaya wallichii Apocytochrome f differ from other plant species?

Crucihimalaya wallichii is a Brassicaceae family member related to Arabidopsis thaliana. While the core functions of Apocytochrome f are conserved across photosynthetic organisms, species-specific variations exist in amino acid sequences, post-translational modifications, and structural elements that may affect protein stability, electron transfer efficiency, or interaction with other components of the photosynthetic apparatus. Comparative analysis with Apocytochrome f from other species like Arabidopsis thaliana, Spinacia oleracea, or Nicotiana tabacum can reveal evolutionary adaptations specific to Crucihimalaya wallichii's ecological niche. These differences may contribute to the plant's adaptation to its native high-altitude Himalayan habitat, potentially conferring advantages in harsh environmental conditions .

What is the molecular structure of Recombinant Crucihimalaya wallichii Apocytochrome f?

The recombinant Apocytochrome f from Crucihimalaya wallichii typically consists of a single polypeptide chain encoded by the chloroplast petA gene. The protein contains specific binding domains for heme attachment and sites for interaction with other components of the cytochrome b6f complex. The protein likely shares the general structural features observed in cytochrome f from other plants: an N-terminal domain containing the heme-binding site, a small domain involved in protein-protein interactions within the cytochrome b6f complex, and a C-terminal transmembrane anchor that secures the protein to the thylakoid membrane. In the recombinant form, modifications may include purification tags (such as His-tags) and potential removal of the membrane-spanning domain to improve solubility for experimental applications .

What expression systems are optimal for producing Recombinant Crucihimalaya wallichii Apocytochrome f?

For successful expression of functional Recombinant Crucihimalaya wallichii Apocytochrome f, several expression systems can be employed, each with distinct advantages. E. coli-based systems provide high yields and simplicity but may struggle with proper folding of plant proteins. Optimization strategies include using specialized E. coli strains with enhanced disulfide bond formation capabilities, codon optimization of the petA gene sequence for bacterial expression, and expressing at lower temperatures (16-20°C) to improve folding. For more authentic post-translational modifications, yeast (P. pastoris) or insect cell systems may be preferable, though with lower yields. The choice depends on research objectives—structural studies may prioritize quantity, while functional analyses require properly folded protein. Regardless of system, purification typically employs affinity chromatography via engineered tags, followed by size exclusion chromatography to ensure homogeneity .

What are the challenges in purifying active Recombinant Crucihimalaya wallichii Apocytochrome f?

Purification of active Recombinant Crucihimalaya wallichii Apocytochrome f presents several significant challenges. The protein's hydrophobic transmembrane domain often causes aggregation during expression and purification, requiring careful detergent selection or strategic truncation of the membrane-spanning region. Additionally, maintaining the protein's native conformation is crucial for experimental validity. Researchers must carefully monitor and optimize buffer conditions (pH, ionic strength, additives) throughout purification. Another critical consideration is the heme cofactor—native cytochrome f contains covalently attached heme, but recombinant production often yields the apoprotein without heme. Successful studies may require in vitro heme reconstitution protocols to obtain the functional holoprotein. Finally, preventing oxidative damage during purification is essential, often necessitating the inclusion of reducing agents and handling under nitrogen atmosphere for sensitive applications .

How can I verify the structural integrity of purified Recombinant Crucihimalaya wallichii Apocytochrome f?

Verifying structural integrity of purified Recombinant Crucihimalaya wallichii Apocytochrome f requires a multi-technique approach. Begin with basic quality assessment using SDS-PAGE to confirm molecular weight and purity, followed by western blotting with antibodies specific to conserved cytochrome f epitopes. For secondary structure analysis, circular dichroism (CD) spectroscopy can determine α-helical and β-sheet content, comparing results to predicted structures or known cytochrome f proteins from related species. Thermal shift assays provide valuable information about protein stability and proper folding. For functional verification, spectrophotometric analysis measuring absorbance at characteristic wavelengths (typically around 550-553 nm for the reduced form) confirms proper heme incorporation and environment. More sophisticated analyses include limited proteolysis to assess domain organization and flexibility, and mass spectrometry for precise molecular weight determination and identification of potential post-translational modifications .

How can Recombinant Crucihimalaya wallichii Apocytochrome f be used in photosynthesis research?

Recombinant Crucihimalaya wallichii Apocytochrome f serves as a powerful tool in photosynthesis research, enabling detailed investigations of electron transport mechanisms. Researchers can employ the purified protein in reconstitution experiments, where it can be incorporated into artificial membrane systems alongside other purified components of the photosynthetic apparatus to study electron transfer kinetics under controlled conditions. Site-directed mutagenesis of the recombinant protein allows systematic analysis of how specific amino acid residues contribute to electron transfer efficiency, redox potential, and interactions with plastocyanin and other proteins. The recombinant protein also facilitates comparative studies examining evolutionary adaptations in photosynthetic mechanisms across different plant species, particularly those adapted to extreme environments like the high-altitude habitats of Crucihimalaya wallichii. Additionally, the protein can be labeled with fluorescent probes or spin labels for advanced biophysical studies investigating protein dynamics during electron transfer events .

What insights can structural studies of Recombinant Crucihimalaya wallichii Apocytochrome f provide?

Structural studies of Recombinant Crucihimalaya wallichii Apocytochrome f can yield valuable insights into photosynthetic electron transport adaptation mechanisms. X-ray crystallography can reveal precise atomic arrangements of the protein, identifying unique structural features that may be adaptations to Crucihimalaya's high-altitude habitat. These studies can elucidate the heme-binding pocket architecture, surface electrostatic properties affecting interactions with electron transfer partners, and potential structural modifications enhancing stability under stress conditions. Comparative analysis with cytochrome f structures from other species can reveal evolutionary patterns in photosynthetic protein structure. Additionally, structural information enables rational design of mutations for functional studies and may identify novel catalytic or regulatory sites. For dynamic understanding, NMR spectroscopy and molecular dynamics simulations can complement crystallographic data by revealing conformational changes during the protein's functional cycle—information crucial for understanding the molecular mechanisms of electron transfer efficiency in this specialized plant species .

How does Recombinant Crucihimalaya wallichii Apocytochrome f interact with other components of the photosynthetic electron transport chain?

Recombinant Crucihimalaya wallichii Apocytochrome f interactions with other photosynthetic components can be studied through several complementary approaches. Surface plasmon resonance (SPR) provides quantitative binding kinetics between the recombinant protein and partners like plastocyanin or the cytochrome b6 subunit, revealing association/dissociation rates and equilibrium constants that characterize these interactions. Isothermal titration calorimetry (ITC) offers thermodynamic profiles, detailing entropy and enthalpy contributions to binding. Co-immunoprecipitation studies can identify novel interaction partners when coupled with mass spectrometry. For detailed mapping of interaction interfaces, hydrogen-deuterium exchange mass spectrometry (HDX-MS) reveals regions of altered solvent accessibility upon complex formation. Cross-linking mass spectrometry provides complementary data on spatial proximity between specific residues. When applying these techniques, researchers should consider how the recombinant protein's properties might differ from the native context, particularly regarding post-translational modifications and membrane environment influences that may affect interaction dynamics .

What spectroscopic methods are most informative for studying Recombinant Crucihimalaya wallichii Apocytochrome f?

Several spectroscopic methods provide valuable insights into Recombinant Crucihimalaya wallichii Apocytochrome f's properties and function. UV-visible absorption spectroscopy reveals characteristic peaks (α-band at ~552 nm, β-band at ~523 nm, and Soret band at ~415 nm in the reduced state) that confirm proper heme incorporation and environment. Monitoring these spectral features during redox titrations determines the protein's redox potential—a crucial functional parameter. Circular dichroism spectroscopy in both far-UV (190-250 nm) and near-UV (250-350 nm) regions provides information about secondary structure and tertiary folding, respectively. For more detailed structural insights, resonance Raman spectroscopy probes the heme environment and iron coordination state through vibrational modes. Electron paramagnetic resonance (EPR) spectroscopy can characterize the electronic structure of the heme iron in different oxidation states. Fluorescence spectroscopy, while limited by heme quenching effects, can still provide information about protein conformation and stability when strategically applied to specific regions or using extrinsic fluorophores .

How can I design comparative experiments between Crucihimalaya wallichii Apocytochrome f and other species variants?

Designing rigorous comparative experiments between Crucihimalaya wallichii Apocytochrome f and variants from other species requires careful methodological planning. Begin with standardized expression and purification protocols to minimize preparation-related variables—identical tags, expression systems, and purification steps ensure differences observed are intrinsic to the proteins rather than artifacts. Biophysical characterization should include thermal stability assays, circular dichroism measurements, and absorbance spectra under identical buffer conditions, documenting differences in structural stability and cofactor environments. For functional comparisons, electron transfer kinetics with standardized electron donors and acceptors (such as reduced cytochrome c or artificial electron acceptors) provide quantitative metrics of catalytic efficiency. Sequence-structure-function relationships can be established through targeted mutagenesis, converting key residues in one variant to match the other. Environmental response experiments examining activity and stability under varying conditions (temperature, pH, salt concentration) may reveal specialized adaptations reflecting each species' ecological niche. Throughout these studies, statistical robustness requires multiple independent protein preparations and technical replicates .

What data analysis approaches should be used when comparing electron transfer kinetics of different Apocytochrome f variants?

When analyzing electron transfer kinetics of different Apocytochrome f variants, including Crucihimalaya wallichii, researchers should employ a comprehensive data analysis framework. Primary kinetic data from stopped-flow spectroscopy or other time-resolved techniques should first undergo model fitting to extract rate constants, applying appropriate reaction mechanisms (single-exponential, multi-exponential, or more complex models). Statistical validation using residual analysis, F-tests, and Akaike Information Criterion helps identify the most appropriate kinetic model. Beyond simple rate comparison, researchers should calculate activation parameters (ΔH‡, ΔS‡, ΔG‡) through temperature-dependent measurements, providing insights into transition state properties that may differ between variants. Correlation analysis between kinetic parameters and structural features (from sequence analysis or structural data) can identify determinants of functional differences. For complex datasets comparing multiple variants under various conditions, multivariate statistical approaches like principal component analysis or hierarchical clustering help identify patterns and relationships that might not be apparent from individual comparisons. Throughout analysis, propagation of experimental uncertainty should be rigorously tracked to ensure meaningful interpretation of variant differences .

How might Recombinant Crucihimalaya wallichii Apocytochrome f contribute to understanding plant adaptation to extreme environments?

Recombinant Crucihimalaya wallichii Apocytochrome f offers a unique window into photosynthetic adaptations to extreme environments. Crucihimalaya wallichii thrives in high-altitude Himalayan regions, where plants face intense UV radiation, temperature fluctuations, and limited resources. Comparative studies examining electron transfer efficiency, redox potential, and structural stability between this protein and homologs from lowland species could reveal molecular adaptations that optimize photosynthesis under harsh conditions. Researchers might investigate whether this protein exhibits enhanced structural stability, altered electrostatic surface properties facilitating faster electron transfer, or modified redox properties optimized for high-altitude light conditions. Site-directed mutagenesis experiments converting residues between highland and lowland species variants can identify specific amino acids responsible for environmental adaptations. Integration with whole-plant physiological studies and genomic data would provide a comprehensive understanding of how molecular-level adaptations in electron transport components translate to ecological success. This research direction has broader implications for understanding plant climate adaptation mechanisms and potentially developing more resilient crops for changing environmental conditions .

What emerging technologies might enhance structural and functional studies of Recombinant Crucihimalaya wallichii Apocytochrome f?

Emerging technologies are poised to revolutionize our understanding of Recombinant Crucihimalaya wallichii Apocytochrome f structure and function. Cryo-electron microscopy (cryo-EM) now achieves near-atomic resolution without crystallization requirements, potentially revealing the protein's structure in more native-like environments including membrane associations. Time-resolved serial crystallography using X-ray free-electron lasers (XFELs) could capture transient conformational states during electron transfer, creating "molecular movies" of the protein's functional cycle. For in-solution dynamics, advanced nuclear magnetic resonance (NMR) techniques including TROSY and relaxation dispersion methods can characterize protein motions across multiple timescales. Integrative structural biology approaches combining multiple experimental data sources with computational modeling will provide more complete structural models. On the functional side, single-molecule spectroscopy techniques may reveal heterogeneity in electron transfer behavior masked in ensemble measurements. Meanwhile, advanced computational methods including quantum mechanics/molecular mechanics (QM/MM) simulations can provide unprecedented detail on electron transfer mechanisms, while machine learning approaches may identify subtle structure-function relationships across multiple cytochrome f variants .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.