Recombinant Crucihimalaya wallichii Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If a specific tag type is required, please inform us, and we will prioritize its implementation.
Synonyms
cemA; ycf10; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Crucihimalaya wallichii (Rock-cress) (Arabidopsis campestris)
Target Names
cemA
Target Protein Sequence
MAKKKAFIPFFYFTSIVFLPWLISLCCNKSLKTWITNWWNTRQCETFLNDIQEKSVLEKF IQLEDLFQLDEMIKEYPETDLQQFRLGIHKETIQFIKIHNEYRIHTILHFSTNLISFVIL SGYSFWAKEKLFILNSWVQEFLYNLSDTIKAFSILLVTDLCIGFHSPHGWELMIGYIYKD FGFAHYEQILSGLVSTFPVILDTIFKYWIFRYLNRVSPSLVVIYHAIND
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly facilitates efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is cemA and what is its role in chloroplast function?

cemA (also known as ycf10) is a chloroplast envelope membrane protein encoded by the chloroplast genome. It is part of the essential gene complement found in most land plant chloroplast genomes. While its precise function remains under investigation, studies suggest cemA is involved in:

  • CO₂ uptake and carbon concentration mechanisms

  • Proton flux across the chloroplast envelope membrane

  • Maintenance of photosynthetic efficiency under varying environmental conditions

The protein contains multiple transmembrane domains, consistent with its role as an integral membrane protein in the chloroplast envelope .

How is the cemA gene organized in the Crucihimalaya wallichii chloroplast genome?

The cemA gene in C. wallichii is located in the large single copy (LSC) region of the chloroplast genome. Like other chloroplast genes, it exists in a conserved syntenic block. Specifically:

  • The gene order around cemA typically follows: ycf4—cemA—petA

  • The intergenic region between ycf4 and cemA spans approximately 942 bp and shows relatively high divergence (26.69%) when compared across related species

  • The cemA gene encodes a protein of 229 amino acids in C. wallichii

  • The gene is transcribed as part of the chloroplast polycistronic transcriptional units

What storage and handling conditions are optimal for recombinant cemA protein?

For optimal stability and activity of recombinant C. wallichii cemA protein:

  • Store stock solutions at -20°C, or at -80°C for extended storage periods

  • Use a Tris-based buffer containing 50% glycerol for storage

  • Avoid repeated freeze-thaw cycles as they lead to protein denaturation

  • Working aliquots can be maintained at 4°C for up to one week

  • When designing experiments, account for the protein's hydrophobic transmembrane domains when selecting buffers and detergents

What purification strategies are most effective for cemA and other chloroplast membrane proteins?

Purification of cemA presents challenges due to its hydrophobic nature as a membrane protein. Recommended approaches include:

  • Detergent-based extraction:

    • Use mild non-ionic detergents (e.g., n-dodecyl-β-D-maltoside or digitonin)

    • Gradually increase detergent concentration to avoid protein aggregation

    • Include glycerol (10-20%) to stabilize membrane proteins

  • Affinity chromatography:

    • Express recombinant cemA with affinity tags (His-tag is commonly used)

    • Immobilized metal affinity chromatography (IMAC) with Ni-NTA resin

    • Elute with imidazole gradient

  • Size exclusion chromatography:

    • Final polishing step to remove aggregates

    • Use detergent-containing buffers throughout purification

Membrane protein purity should be assessed using both SDS-PAGE and Western blotting techniques .

How can researchers effectively reconstitute cemA function for in vitro studies?

Functional reconstitution of cemA requires:

  • Liposome preparation:

    • Use chloroplast lipid extracts or synthetic lipid mixtures mimicking chloroplast envelope composition (phosphatidylcholine, phosphatidylglycerol, and monogalactosyldiacylglycerol)

    • Prepare unilamellar vesicles (100-200 nm) by extrusion

  • Protein incorporation:

    • Reconstitute purified cemA using detergent-mediated insertion

    • Gradually remove detergent using Bio-Beads or dialysis

    • Maintain protein:lipid ratio between 1:100 and 1:1000 (w/w)

  • Functional assays:

    • Measure proton flux using pH-sensitive fluorescent dyes

    • Assess membrane integrity using carboxyfluorescein leakage assays

    • Monitor CO₂ uptake in reconstituted proteoliposomes

This approach allows for detailed biochemical characterization without cellular complexity .

What expression systems are most suitable for producing functional recombinant cemA protein?

Selecting the appropriate expression system depends on research objectives:

Expression SystemAdvantagesLimitationsApplications
E. coliHigh yield, fast growth, economicLacks post-translational modifications, potential for inclusion bodiesStructural studies, antibody production
Insect cellsBetter folding of complex proteins, some PTMsMore expensive, longer production timeFunctional studies, protein-protein interactions
Chloroplast-basedNative environment, natural PTMsLower yield, technically challengingIn vivo functional studies
Cell-freeAvoids toxicity issues, rapidExpensive, limited scaleStructural studies of membrane proteins

For most applications, E. coli expression using specialized strains (C41/C43) and fusion partners that enhance membrane protein folding (e.g., MBP, SUMO) provides a good balance between yield and functionality .

How does the sequence and structure of cemA differ between Crucihimalaya wallichii and other Brassicaceae species?

Comparative analysis reveals evolutionary patterns in cemA across Brassicaceae:

  • Sequence conservation:

    • The core transmembrane domains show higher conservation than terminal regions

    • The amino acid sequence identity between C. wallichii and Arabidopsis thaliana cemA is approximately 85-90%

  • Structural variations:

    • Species adapted to extreme environments (like C. wallichii) show specific amino acid substitutions that may affect protein stability

    • The hydrophobicity profile remains consistent across species, maintaining the membrane-spanning capability

  • Notable differences:

    • C. wallichii cemA contains modifications in the N-terminal region compared to lowland relatives

    • Substitutions in transmembrane domains may affect protein-lipid interactions in species adapted to cold environments

What evidence exists for cemA involvement in adaptation to high-altitude environments?

Several lines of evidence suggest cemA's potential role in alpine adaptation:

  • Selective pressure analysis:

    • Genes involved in photosynthesis and membrane functions show signatures of positive selection in highland Crucihimalaya species

    • cemA shows elevated Ka/Ks ratios compared to lowland relatives, suggesting adaptive evolution

  • Functional implications:

    • Amino acid substitutions in cemA of highland plants may enhance chloroplast envelope stability under cold conditions

    • Modified protein properties could maintain carbon uptake efficiency at reduced atmospheric CO₂ concentrations at high altitudes

  • Comparative studies:

    • C. himalaica genome analysis revealed expansion in gene families associated with DNA repair and ubiquitin-mediated proteolysis

    • These adaptations help plants survive in high-UV, low-temperature environments of the Qinghai-Tibet Plateau

How does cemA contribute to chloroplast genome evolution in the Brassicaceae family?

cemA provides insights into chloroplast genome evolution patterns:

  • Synteny analysis:

    • The ycf4-cemA intergenic region shows higher divergence (26.69%) compared to other chloroplast regions

    • This suggests relaxed selective constraints in non-coding regions adjacent to cemA

  • Phylogenetic utility:

    • cemA sequence variation contributes to resolving evolutionary relationships within Brassicaceae

    • The gene shows suitable levels of variation for family-level phylogenetic studies

  • Evolutionary rates:

    • When comparing 76 shared chloroplast genes between B. sacra and A. indica, cemA showed significant sequence diversity

    • This indicates uneven evolutionary rates across the chloroplast genome, with cemA evolving more rapidly than many other chloroplast genes

How can cemA be used as a tool for investigating chloroplast envelope biogenesis?

cemA offers unique opportunities for studying chloroplast envelope development:

  • Protein import and targeting studies:

    • Fusion of fluorescent proteins to cemA allows visualization of envelope membrane targeting

    • In vitro import assays can determine if cemA follows the "post-import" mechanism observed for other envelope proteins like atTic40 and atTic110

  • Membrane domain organization:

    • Using cemA as a marker for specific envelope subdomains

    • Investigating protein-protein interactions between cemA and other envelope components

  • Experimental approaches:

    • FRET/BiFC assays to analyze protein interactions in vivo

    • Pulse-chase experiments to track cemA biosynthesis and turnover

    • Cryoelectron microscopy to visualize membrane organization

These approaches can extend findings from previous studies showing that inner envelope membrane proteins like atTic40 are first imported from the cytoplasm and subsequently inserted into the membrane from the stroma .

What are the challenges in distinguishing genuine chloroplast envelope proteins from contaminants in proteomics studies?

Accurate identification of envelope proteins poses methodological challenges:

  • Sources of contamination:

    • High-abundance thylakoid proteins often contaminate envelope preparations

    • Proteins from other organelles (especially mitochondria) may co-purify

    • Some proteins dynamically associate with multiple compartments

  • Quantitative approaches:

    • Calculate Enrichment Factor (EF) by comparing relative abundance in purified envelopes versus crude extracts

    • Proteins like cemA show high EF values (>5) confirming their envelope localization

    • Integration of multiple datasets and cross-validation improve confidence

  • Complementary methods:

    • Fluorescent protein tagging and microscopy

    • Membrane fractionation using multiple techniques

    • Protein complexome analysis to identify interaction partners

This comprehensive approach has helped expand the chloroplast envelope proteome from ~117 to >462 proteins in recent studies .

How might structural modifications to cemA affect photosynthetic efficiency under varying environmental conditions?

Understanding structure-function relationships in cemA could reveal adaptation mechanisms:

  • Critical domains for function:

    • Transmembrane helices facilitate integration into the membrane

    • Charged residues in loop regions likely contribute to ion transport

    • N-terminal and C-terminal domains may interact with other envelope components

  • Environmental response elements:

    • Specific residues may act as sensors for pH, temperature, or other environmental factors

    • Post-translational modifications could regulate activity under stress conditions

  • Experimental approaches to investigate:

    • Site-directed mutagenesis of conserved residues

    • Chimeric proteins combining domains from high-altitude and low-altitude species

    • In vivo chlorophyll fluorescence analysis to assess photosynthetic performance

    • Gas exchange measurements under varying CO₂ concentrations and temperatures

These investigations could reveal how chloroplast envelope proteins contribute to photosynthetic adaptations in extreme environments .

How does cemA interact with other chloroplast envelope proteins in a functional network?

Current research points toward an integrated functional network:

  • Potential interaction partners:

    • Other envelope transporters and channels

    • Components of protein import machinery (TOC/TIC complexes)

    • Proteins involved in lipid metabolism and membrane organization

  • Network analysis approaches:

    • Pull-down assays combined with mass spectrometry

    • Yeast two-hybrid or split-ubiquitin assays adapted for membrane proteins

    • In situ proximity labeling (BioID/TurboID) to identify neighboring proteins

  • Functional implications:

    • Formation of multiprotein complexes affecting envelope permeability

    • Coordinated regulation of multiple transporters

    • Integration of signaling between chloroplast and cytosol

Understanding these interactions would provide a systems-level view of chloroplast envelope function .

Can CRISPR-based technologies be applied to modify cemA in chloroplast genomes for enhanced photosynthetic performance?

Emerging chloroplast genome engineering approaches offer new possibilities:

  • Technical approaches:

    • Chloroplast-targeted CRISPR-Cas9 systems

    • Homology-directed repair using transplastomic techniques

    • Precise base editing to introduce specific amino acid changes

  • Potential modifications:

    • Introduction of cemA variants from extremophile plants into crop species

    • Engineering modified cemA proteins with enhanced stability or activity

    • Adjusting expression levels through promoter modifications

  • Expected outcomes:

    • Improved photosynthetic efficiency under stress conditions

    • Enhanced carbon uptake in crops

    • Increased resilience to temperature fluctuations

This approach would build on successful chloroplast genome editing techniques while targeting specific adaptations observed in high-altitude plants like C. wallichii .

How does the role of cemA compare in C3, C4, and CAM photosynthetic systems?

Comparative analysis across photosynthetic types may reveal specialized functions:

  • Physiological context:

    • C3 plants (like Crucihimalaya) rely primarily on Rubisco for CO₂ fixation

    • C4 and CAM plants have carbon-concentrating mechanisms

    • cemA's role may differ based on these physiological strategies

  • Comparative evidence:

    • Sequence conservation patterns across diverse plant lineages

    • Expression level variations between photosynthetic types

    • Potentially different interaction partners in specialized chloroplasts

  • Research approaches:

    • Comparative genomics across C3/C4/CAM species

    • Expression studies under varying CO₂ concentrations

    • Heterologous expression of cemA variants in different photosynthetic backgrounds

This research direction could provide insights into the evolution of photosynthetic diversity and identify targets for crop improvement .

What analytical methods are most suitable for assessing the quality and activity of recombinant cemA preparations?

Quality control for recombinant cemA requires multiple analytical approaches:

  • Biophysical characterization:

    • Circular dichroism (CD) to assess secondary structure integrity

    • Dynamic light scattering (DLS) to evaluate homogeneity and aggregation state

    • Thermal shift assays to determine protein stability

  • Functional assessment:

    • Reconstitution into liposomes for transport activity measurements

    • Binding assays with potential interaction partners

    • Electron microscopy to verify proper membrane integration

  • Purity verification:

    • SDS-PAGE with both Coomassie and silver staining

    • Western blotting using antibodies against the protein and any affinity tags

    • Mass spectrometry to confirm identity and detect post-translational modifications

These methods ensure that the recombinant protein maintains native-like properties for reliable experimental results .

How can researchers address the challenges of generating antibodies against highly conserved membrane proteins like cemA?

Antibody production for membrane proteins presents specific challenges:

  • Antigen design strategies:

    • Use hydrophilic loops or terminal domains rather than full-length protein

    • Design synthetic peptides corresponding to unique, accessible regions

    • Consider using recombinant fragments fused to carrier proteins

  • Production approaches:

    • Genetic immunization using DNA encoding cemA fragments

    • Phage display selection for highly specific monoclonal antibodies

    • Use of specialized adjuvants for membrane protein antigens

  • Validation requirements:

    • Test antibody specificity across multiple related species

    • Verify recognition of native protein by immunolocalization

    • Confirm lack of cross-reactivity with other chloroplast proteins

Properly validated antibodies can enable various applications including western blotting, immunolocalization, and immunoprecipitation studies .

What are the key considerations when designing cemA gene constructs for heterologous expression?

Optimal expression construct design significantly impacts protein yield and quality:

  • Expression optimization:

    • Codon optimization for the host expression system

    • Inclusion of appropriate affinity tags (His, FLAG, Strep-II)

    • Consideration of fusion partners (MBP, SUMO, Mistic) to enhance membrane protein expression

  • Purification strategy:

    • N-terminal vs. C-terminal tag placement based on predicted topology

    • Inclusion of protease cleavage sites for tag removal

    • Selection of appropriate promoters and terminators

  • Construct modifications for specific applications:

    • Fluorescent protein fusions for localization studies

    • Site-specific mutations to investigate structure-function relationships

    • Chimeric constructs combining domains from different species

These design principles apply broadly to membrane proteins while addressing the specific challenges of cemA expression and purification .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.