Recombinant Crucihimalaya wallichii NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us for prioritized development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Crucihimalaya wallichii (Rock-cress) (Arabidopsis campestris)
Target Names
ndhC
Target Protein Sequence
MFLLYEYDIFWAFLIISSAIPVLAFLISGVLSPIRKGPEKLSSYESGIEPIGDAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSAFIEAFIFVLILILGLVYAWRKGALEWS
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) facilitates electron transfer from NAD(P)H:plastoquinone, utilizing FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, plastoquinone is considered the primary electron acceptor. The enzyme couples this redox reaction to proton translocation, conserving redox energy as a proton gradient.
Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the taxonomic classification of Crucihimalaya wallichii?

Crucihimalaya wallichii, previously known as Arabidopsis campestris or Rock-cress, is a plant species belonging to the Brassicaceae family. The taxonomic classification is maintained in the NCBI Taxonomy database . Crucihimalaya wallichii is phylogenetically related to other Brassicaceae members including Arabidopsis thaliana, Capsella rubella, and Camelina microcarpa .

Comparative phylogenetic analyses place Crucihimalaya wallichii in proximity to other species that have been studied for their NAD(P)H-quinone oxidoreductase components, including various Arabidopsis species . This taxonomic relationship facilitates comparative studies of the enzyme across evolutionarily related plant species.

How does NAD(P)H-quinone oxidoreductase function in plant chloroplasts?

In plant chloroplasts, NAD(P)H-quinone oxidoreductase functions as part of the cyclic electron transport chain. This enzyme complex catalyzes the oxidation of NAD(P)H and the reduction of plastoquinone, contributing to ATP production without accumulating reducing power. The chloroplastic NAD(P)H-quinone oxidoreductase consists of multiple subunits (including subunit 3) that work together to facilitate electron transfer .

The enzyme's primary function involves:

  • Accepting electrons from NAD(P)H

  • Transferring these electrons through its FAD cofactor

  • Reducing quinone to hydroquinone

  • Contributing to the proton gradient across the thylakoid membrane

This process is essential for balancing the redox state in chloroplasts during varying light conditions and plays a role in photoprotection mechanisms .

What methods can be used to evaluate the activity of recombinant Crucihimalaya wallichii NAD(P)H-quinone oxidoreductase?

Multiple methodological approaches can be employed to assess the activity of recombinant Crucihimalaya wallichii NAD(P)H-quinone oxidoreductase:

Spectrophotometric Assays:

  • Monitor NAD(P)H oxidation at 340 nm using a plate reader or spectrophotometer

  • Reaction mixtures typically contain: 50 µM quinone substrate, 500 µM NAD(P)H, and enzyme (0.1-10 µg) in buffer (e.g., 20 mM Tris-HCl pH 8, 100 mM NaCl)

  • Record the decrease in absorbance at 340 nm to calculate the rate of NAD(P)H oxidation

Western Blot Analysis:

  • Use antibodies specific to NAD(P)H-quinone oxidoreductase to detect the protein

  • Recommended dilution for Western blot using anti-NAD(P)H-quinone oxidoreductase antibodies: 1:1000

  • Expected molecular weight for detection: varies by subunit (for related subunits, approximately 35 kDa)

Enzyme-Linked Immunosorbent Assay (ELISA):

  • Commercial ELISA kits are available for the detection and quantification of the recombinant protein

Oxygen Consumption Measurement:

  • Monitor oxygen consumption as an indicator of enzyme activity using oxygen electrodes or optical sensors

  • In purified enzyme systems, a 1:1 stoichiometry of oxygen consumption to NADH oxidation with hydrogen peroxide production has been observed for related NAD(P)H-quinone oxidoreductases

How should researchers handle and store recombinant Crucihimalaya wallichii NAD(P)H-quinone oxidoreductase?

Proper handling and storage of recombinant Crucihimalaya wallichii NAD(P)H-quinone oxidoreductase is crucial for maintaining enzyme activity. The following protocols are recommended:

Storage Conditions:

  • Store lyophilized protein at -20°C or -80°C for extended storage

  • For reconstituted protein, store in aliquots at -20°C

  • Working aliquots can be stored at 4°C for up to one week

Storage Buffer:

  • Typically supplied in a Tris-based buffer with 50% glycerol, optimized for protein stability

  • Some commercial preparations include 6% trehalose in PBS-based buffer, pH 8.0

Handling Precautions:

  • Avoid repeated freeze-thaw cycles as this significantly reduces enzyme activity

  • Briefly centrifuge vials before opening to bring contents to the bottom

  • For reconstitution, add sterile water or appropriate buffer as specified by the supplier

Reconstitution Protocol:

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 20-50% for long-term storage

  • Make small aliquots to avoid repeated freezing and thawing

What experimental controls should be included when studying recombinant NAD(P)H-quinone oxidoreductase activity?

When designing experiments to study the activity of recombinant Crucihimalaya wallichii NAD(P)H-quinone oxidoreductase, the following controls should be included:

Negative Controls:

  • Reaction mixture without enzyme to account for non-enzymatic NAD(P)H oxidation or quinone reduction

  • Heat-inactivated enzyme (95°C for 10 minutes) to confirm the observed activity is enzyme-dependent

  • Reactions in the presence of specific inhibitors like dicoumarol (for mammalian homologs) to verify specificity

Positive Controls:

  • Well-characterized NAD(P)H-quinone oxidoreductase from model organisms (e.g., Arabidopsis thaliana)

  • Commercial enzyme standards with known activity units

  • For antibody-based detection methods, include purified protein standards

Substrate Controls:

  • Vary substrate concentrations to establish enzyme kinetics (KM and Vmax)

  • Include alternative quinone substrates to assess substrate specificity

  • Control for quinone solubility issues by maintaining consistent DMSO concentrations across all reactions (typically 5% v/v)

Buffer and Environmental Controls:

  • pH controls to determine optimum pH for activity

  • Temperature controls to establish optimal reaction temperatures

  • Test both NADH and NADPH as electron donors to determine cofactor preference

How do conformational changes impact the activity of NAD(P)H-quinone oxidoreductase?

NAD(P)H-quinone oxidoreductases undergo significant conformational changes during their catalytic cycle that directly impact their activity. Based on studies of homologous proteins:

Structural Organization and Dynamics:

  • The catalytically active form is typically a homodimer with active sites formed at the interface between monomers

  • The active sites contain a noncovalent binding pocket for FAD

  • The enzyme undergoes a conformational change after NAD(P)H binding, facilitating the release of oxidized pyridine nucleotide and creating an environment for quinone binding

Ping-Pong Bi-Bi Kinetic Mechanism:

  • NAD(P)H binds first, reducing the enzyme-bound FAD

  • The oxidized NAD(P)+ is released

  • Quinone substrate binds to the reduced enzyme

  • After electron transfer, the reduced quinone (hydroquinone) is released

Local and Long-Range Conformational Effects:

  • Mutations in key residues can affect protein stability and dynamics

  • For example, in human NQO1 (a homolog), the p.P187S variant shows reduced thermal stability and increased mobility

  • Local stabilization of flexible loops can partially rescue FAD binding affinity through a population shift in the conformational ensemble

  • Long-range communication between domains affects substrate binding and catalysis, with mutations in one domain impacting the function of distant regions of the protein

What structural and functional differences exist between plant and mammalian NAD(P)H-quinone oxidoreductases?

Plant and mammalian NAD(P)H-quinone oxidoreductases share similar catalytic mechanisms but exhibit important structural and functional differences:

Plant Chloroplastic NAD(P)H-quinone oxidoreductases:

  • Located in chloroplasts and involved in photosynthetic electron transport

  • Consist of multiple subunits (including subunit 3, the focus of this FAQ)

  • Function within the thylakoid membrane

  • Generally classified as Type II NAD(P)H:quinone oxidoreductases (NDH-2)

  • Lack energy-transducing sites

  • May have covalently bound FMN in some cases instead of FAD

  • Some variants contain EF-hand motifs that bind calcium

Mammalian NAD(P)H-quinone oxidoreductases:

  • Two main types in mammals: NQO1 and NQO2

  • Function in detoxification and protection against oxidative stress

  • NQO1 exerts multiple biological activities including:

    • Antioxidant activities

    • Anti-inflammatory effects

    • Interactions with tumor suppressors

    • Protection against cardiovascular damage

    • Roles in metabolic diseases

  • Structurally distinct from plant enzymes

  • Can generate NAD+ during reduction of certain substrates like β-lapachone, which can influence cellular NAD+:NADH ratios

  • Act as superoxide scavengers, with the ability to react with and detoxify superoxide radicals

Functional Comparison:

  • Both reduce quinones to less toxic hydroquinones

  • Plant enzymes are primarily involved in electron transport

  • Mammalian enzymes have evolved additional roles in xenobiotic detoxification and redox regulation

  • Substrate specificity profiles differ significantly due to structural adaptations in the active site regions

How is substrate specificity determined in NAD(P)H-quinone oxidoreductases?

Substrate specificity in NAD(P)H-quinone oxidoreductases is determined by multiple structural and biochemical factors:

Active Site Architecture:

  • The size and shape of the active site significantly influence which substrates can bind

  • Enzymes with larger active sites can accommodate bulkier quinone substrates

  • For example, in bacterial homologs, differences in active site volume correlate with preferences for either benzoquinones or naphthoquinones

Key Residue Substitutions:

  • Specific amino acid substitutions at key positions alter substrate preferences

  • In bacterial homologs, substitutions at positions equivalent to F60 affect substrate specificity

  • Residues that stabilize the negative charge on reduced FAD (like histidine or tyrosine) influence reactivity

Stabilization of Reaction Intermediates:

  • Different enzymes vary in their ability to stabilize the reduced flavin intermediate

  • In some bacterial enzymes, this stabilization occurs through interactions with His144 or Tyr145

  • The absence of stabilizing residues (e.g., when a phenylalanine is present instead) alters reactivity

Experimental Determination of Substrate Specificity:
Researchers can determine substrate specificity profiles by:

  • Testing enzyme activity with a panel of different quinone substrates

  • Monitoring NAD(P)H oxidation rates spectrophotometrically

  • Calculating specific activities for each substrate

  • Comparing relative rates to identify preferred substrates

From studies of bacterial homologs, distinct patterns emerge:

  • Some enzymes prefer benzoquinones

  • Others prefer naphthoquinones

  • Some show broader specificity for both classes

  • Rates of quinone reduction can be up to two orders of magnitude higher than rates of azo compound reduction, suggesting quinones may be more physiologically relevant substrates

How conserved is NAD(P)H-quinone oxidoreductase across different plant species?

NAD(P)H-quinone oxidoreductase shows significant conservation across plant species, though with important variations:

Sequence Conservation Analysis:
Based on studies of related proteins like chalcone synthase (another enzyme in plant metabolism), we can infer conservation patterns. For example, in a study of chalcone synthase across 29 plant species:

  • Query coverage: 98-100%

  • Sequence identity: 96.93-100%

  • Similar conservation patterns likely exist for NAD(P)H-quinone oxidoreductase components

Cross-Species Reactivity:
The conservation of NAD(P)H-quinone oxidoreductase structure is reflected in antibody cross-reactivity:

  • Antibodies against the Arabidopsis thaliana NdhB protein (another NAD(P)H-quinone oxidoreductase subunit) show confirmed reactivity with homologs from Hordeum vulgare and Zea mays

  • The same antibodies have predicted reactivity with Crucihimalaya wallichii and numerous other plant species

Predicted Reactivity List:
Antibodies against NAD(P)H-quinone oxidoreductase subunits show predicted reactivity with:

  • Anastatica hierochuntica

  • Arabis stelleri

  • Barbarea verna

  • Braya humilis

  • Bunias orientalis

  • Camelina sativa

  • Cannabis sativa

  • Capsella species

  • Crucihimalaya wallichii

  • And many others

This broad cross-reactivity indicates high conservation of epitope regions across diverse plant species, particularly within the Brassicaceae family.

What is the significance of studying Crucihimalaya wallichii NAD(P)H-quinone oxidoreductase in comparative plant biology?

Studying Crucihimalaya wallichii NAD(P)H-quinone oxidoreductase provides several valuable insights for comparative plant biology:

Evolutionary Understanding:

  • Crucihimalaya wallichii represents an important evolutionary position within Brassicaceae

  • Comparing its NAD(P)H-quinone oxidoreductase with those from model plants like Arabidopsis thaliana helps trace the evolution of photosynthetic electron transport systems

  • Understanding sequence and functional conservation illuminates selective pressures on this essential enzyme complex

Structural and Functional Adaptations:

  • Variations in NAD(P)H-quinone oxidoreductase across species may reflect adaptations to different environmental conditions

  • Studying these variations can reveal how plants have evolved different strategies for managing electron transport and oxidative stress

  • Comparative analysis helps identify conserved functional domains versus variable regions that may confer species-specific properties

Biotechnological Applications:

  • Knowledge of cross-species variation in NAD(P)H-quinone oxidoreductase can inform engineering of photosynthetic organisms with enhanced efficiency

  • Understanding the specific properties of Crucihimalaya wallichii NAD(P)H-quinone oxidoreductase may reveal unique features with biotechnological potential

  • Comparative studies facilitate the identification of optimal enzyme variants for specific applications

Stress Response Mechanisms:

  • NAD(P)H-quinone oxidoreductases play important roles in oxidative stress management

  • Comparing how different species' enzymes respond to stress conditions provides insights into plant stress adaptation

  • This knowledge contributes to our understanding of plant survival mechanisms under adverse conditions

How do Type II NAD(P)H-quinone oxidoreductases differ from Type I enzymes, and where does the Crucihimalaya wallichii enzyme fit?

The classification of NAD(P)H-quinone oxidoreductases into Type I and Type II categories reflects fundamental differences in structure and function:

Type I NAD(P)H-quinone oxidoreductases:

  • Complex, multi-subunit enzymes (typically 14+ subunits)

  • Contain FMN and multiple iron-sulfur clusters

  • Energy-transducing (contribute to proton gradient formation)

  • Inhibited by rotenone

  • Integral membrane protein complexes

  • Found in mitochondria of many eukaryotes and in some bacteria

Type II NAD(P)H-quinone oxidoreductases (NDH-2):

  • Simpler structure, typically single-subunit enzymes

  • Traditionally described as lacking FMN and iron-sulfur clusters

  • Contain non-covalently bound FAD as cofactor (with some exceptions)

  • Non-energy-transducing (do not contribute to proton gradient)

  • Rotenone-insensitive

  • Often associated with membranes but not integral membrane proteins

  • Found in plants, fungi, and many bacteria

Exceptions and Variations:

  • Some Type II enzymes have been found to contain covalently bound FMN instead of FAD

  • A few Type II enzymes contain non-covalently bound FMN

  • Some Type II enzymes contain EF-hand motifs that bind calcium

Crucihimalaya wallichii NAD(P)H-quinone oxidoreductase classification:

  • Based on available information, the Crucihimalaya wallichii NAD(P)H-quinone oxidoreductase subunit 3 appears to be part of a Type II complex

  • It functions in the chloroplast as part of the plastidial electron transport system

  • The enzyme likely functions similarly to other plant Type II NAD(P)H-quinone oxidoreductases in cycling electrons without energy transduction

pH-Dependent Cofactor Preference:

  • At alkaline pH, the oxidation of NADPH can be prevented by electrostatic repulsion between negative charges of the phosphate group of NADPH and membrane phospholipids

  • This may influence whether the enzyme preferentially uses NADH or NADPH depending on cellular conditions

What role does NAD(P)H-quinone oxidoreductase play in oxidative stress protection?

NAD(P)H-quinone oxidoreductase serves as a key component in cellular defense against oxidative stress through multiple mechanisms:

Quinone Detoxification:

  • Catalyzes the two-electron reduction of quinones to hydroquinones

  • This prevents one-electron reduction that would generate semiquinone radicals and reactive oxygen species (ROS)

  • The two-electron reduction is an important detoxification mechanism that generates less toxic metabolites

Direct Antioxidant Functions:

  • Acts as a superoxide scavenger

  • Studies with purified recombinant human NAD(P)H-quinone oxidoreductase 1 (NQO1) show that it can:

    • Inhibit dihydroethidium oxidation

    • Inhibit pyrogallol auto-oxidation

    • Eliminate potassium superoxide-generated signals

    • Consume oxygen in a 1:1 stoichiometry with NADH oxidation, producing hydrogen peroxide

Indirect Protective Mechanisms:

  • Generates NAD+ through oxidation of NADH, which can support DNA repair mechanisms

  • Interacts with other cellular components involved in stress response

  • In mammalian systems, NQO1 stabilizes tumor suppressor proteins like p53

Redox Cycling and NAD+ Generation:

  • Can participate in redox cycling with certain compounds (like β-lapachone in mammalian systems)

  • This cycling can increase NAD+:NADH ratios

  • Elevated NAD+ levels support the activity of sirtuins and poly(ADP-ribose) polymerase (PARP), which are involved in stress response and DNA repair

Evidence from Disease Models:

  • In diabetic nephropathy models, NQO1 activation attenuates oxidative stress and apoptosis

  • Pharmacological activation of NQO1 alleviates various types of oxidative stress-related damage

  • NQO1 protects against cisplatin-induced renal oxidative stress and inflammation by increasing intracellular NAD+ levels

What methodological challenges exist in studying recombinant Crucihimalaya wallichii NAD(P)H-quinone oxidoreductase?

Researchers face several methodological challenges when working with recombinant Crucihimalaya wallichii NAD(P)H-quinone oxidoreductase:

Substrate Solubility Issues:

  • Many quinone substrates have poor aqueous solubility

  • This limits the concentration ranges that can be tested

  • Researchers must balance DMSO (or other solvent) concentrations to solubilize substrates while avoiding enzyme inhibition

  • These solubility constraints can complicate kinetic analyses (KM and Vmax determinations)

NAD(P)H Concentration Limitations:

  • Need to maintain NAD(P)H within the linear detection range of spectrophotometers

  • Must keep NAD(P)H:quinone ratios high enough (typically >5:1) to ensure pseudo-first-order kinetics

  • Background NAD(P)H oxidation can interfere with measurements

Protein Stability Challenges:

  • The enzyme may show reduced stability after purification

  • Repeated freeze-thaw cycles significantly decrease activity

  • Proper buffer composition and storage conditions are critical

Expression and Purification Optimization:

  • Optimizing expression in heterologous systems (typically E. coli)

  • Ensuring proper folding and cofactor incorporation

  • Developing effective purification strategies that maintain activity

  • Confirming that the recombinant protein accurately represents the native enzyme

Assay Development Considerations:

  • Need to distinguish enzyme activity from non-enzymatic reactions

  • Account for potential cofactor preferences (NADH vs. NADPH)

  • Develop appropriate controls for background reactions

  • Consider potential inhibitors or activators present in crude preparations

Experimental Design for Comparative Studies:

  • When comparing with other NAD(P)H-quinone oxidoreductases, standardization of assay conditions is essential

  • Differences in buffer composition, pH, temperature, and substrate concentration can significantly affect results

  • Ensuring comparable protein quality across different preparations is challenging

What future research directions are promising for understanding plant NAD(P)H-quinone oxidoreductases?

Several promising research directions could advance our understanding of plant NAD(P)H-quinone oxidoreductases:

Structural Biology Approaches:

  • Determination of high-resolution crystal structures of plant-specific NAD(P)H-quinone oxidoreductase subunits and complexes

  • Application of cryo-electron microscopy to visualize the complete enzyme complex in native membrane environments

  • NMR studies to understand protein dynamics and conformational changes during catalysis

  • Computational modeling to predict substrate binding and catalytic mechanisms

Systems Biology Integration:

Functional Genomics:

  • CRISPR/Cas9-mediated gene editing to create knockout and knock-in variants

  • Site-directed mutagenesis to investigate the roles of specific residues in catalysis and substrate specificity

  • Development of fluorescent protein fusions to track subcellular localization and dynamics

Comparative Genomics and Evolution:

  • Broader phylogenetic analysis across plant species to understand evolutionary patterns

  • Identification of natural variants with altered function or regulation

  • Correlation of sequence variations with environmental adaptations across plant species

Applied Research Directions:

  • Engineering NAD(P)H-quinone oxidoreductases with enhanced efficiency for improved photosynthesis

  • Development of plants with optimized oxidative stress tolerance through modification of NAD(P)H-quinone oxidoreductase activity

  • Exploration of biocatalytic applications using recombinant plant NAD(P)H-quinone oxidoreductases

Methodological Advances:

  • Development of high-throughput screening methods for NAD(P)H-quinone oxidoreductase activity

  • Implementation of single-molecule techniques to observe individual catalytic events

  • Application of advanced imaging techniques to visualize enzyme distribution and dynamics in vivo

Comparison of NAD(P)H-quinone oxidoreductase subunits from Crucihimalaya wallichii

SubunitUniProt IDLength (aa)Molecular FunctionGene NameLocalization
Subunit 3A4QKT6120Electron transportndhCChloroplastic
Subunit 4LA4QKY6101Electron transportndhEChloroplastic
Subunit 6A4QKY7176Electron transportndhGChloroplastic

Table compiled from search results

Storage and Handling Recommendations for Recombinant NAD(P)H-quinone oxidoreductase

ParameterRecommendationNotes
Storage Temperature-20°C to -80°CFor extended storage
Working Storage4°CUp to one week
Buffer CompositionTris-based buffer with 50% glycerolOptimized for protein stability
Alternative BufferPBS pH 7.4 with 6% trehaloseUsed in some commercial preparations
Freeze-ThawAvoid repeated cyclesSignificantly reduces activity
ReconstitutionAdd sterile water to lyophilized proteinFollow supplier's specific instructions
AliquotingMake small working aliquotsTo avoid repeated freeze-thaw cycles

Table compiled from search results

Predicted Cross-Reactivity of Antibodies Against NAD(P)H-quinone oxidoreductase Subunits

Plant SpeciesFamilyPredicted Reactivity
Crucihimalaya wallichiiBrassicaceaeYes
Arabidopsis thalianaBrassicaceaeConfirmed
Hordeum vulgarePoaceaeConfirmed
Zea maysPoaceaeConfirmed
Anastatica hierochunticaBrassicaceaeYes
Camelina sativaBrassicaceaeYes
Cannabis sativaCannabaceaeYes
Capsella speciesBrassicaceaeYes
Phaseolus vulgarisFabaceaeYes
Oryza sativaPoaceaeYes

Table compiled from search result

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.